����JFIF��������� Mr.X
  
  __  __    __   __  _____      _            _          _____ _          _ _ 
 |  \/  |   \ \ / / |  __ \    (_)          | |        / ____| |        | | |
 | \  / |_ __\ V /  | |__) | __ ___   ____ _| |_ ___  | (___ | |__   ___| | |
 | |\/| | '__|> <   |  ___/ '__| \ \ / / _` | __/ _ \  \___ \| '_ \ / _ \ | |
 | |  | | |_ / . \  | |   | |  | |\ V / (_| | ||  __/  ____) | | | |  __/ | |
 |_|  |_|_(_)_/ \_\ |_|   |_|  |_| \_/ \__,_|\__\___| |_____/|_| |_|\___V 2.1
 if you need WebShell for Seo everyday contact me on Telegram
 Telegram Address : @jackleet
        
        
For_More_Tools: Telegram: @jackleet | Bulk Smtp support mail sender | Business Mail Collector | Mail Bouncer All Mail | Bulk Office Mail Validator | Html Letter private



Upload:

Command:

dccreditrepairto@216.73.216.185: ~ $
����%M�K�d�d�d�de'e?e Vewe�e�e�e�e�e�ef%f%Cfif
f	�f�f�f%�f�f�f�f�fggC-g"qg�g�g)�g&�gh
*h8h	Ah	KhUh]hehmh�h�h�h�h2�hiii(%iNi5_i�i �i=�ijj
,j:jLj(\j�j�j�j�j�j�j�jk%k)8kbknk,�k+�k+�kl
lll)l@l_lhl	~l�l�l	�l
�l	�l+�l	�lT�lGmOmVm"em�m�m�m�m�m
�m
nn&n9nMnUnin�n�n�n�n�n�n�no$o?o,_o#�o#�o)�o�op!p#.pRprp�p�p�p$�p?�p%*qPq$Xq}q%�q�q�q	�q�qr r:rBrQrjr%�r�r�r�r	�rJ�r>EsE�s�s �s�st9&t/`t@�t@�tGuTZu"�u�u�u�uv'v>vUvrv�v�v�v�v�v
�v�v�v�vw
w$w9wNwaw{w�w�w�w�w�w�w�wx/xMxgx�x
�x%�x!�x�x!�x.y(Ly
uy�y
�y�y�y�y�y"�yz"z:z
Zzhz |z�z�z�z@�z+{3{:{J{ ]{~{�{�{�{�{�{�{| |8|R|_|l|�|�|�|�|�|�|
�|�|�|*}.}#L}p}}}�}�}�}�}�}$�}A~;\~.�~(�~�~0?P'm������4�H�f���������ǀ݀��)�5�M�l���#��ˁ؁���)�B�,Z�2��#��ނ(��%2�X�/t�����	ă΃��#�=�F�X�
p�~���	��	��	��	��ʄڄބ���$�!0�(R�%{�����؅�
�)�
1�?�P�d�{�����'����%�?�\�c�s�
������ɇه����)+�U�e�x�������Ȉ"�"�
.� <�]�i�
}�����É#ى���$�A�F�I�\�o�*������Ҋ&�
�(�9�K� T�u���������̋݋��
�%&�L�\�h�t����� ��Čӌ���
�#�8�"X�{�"����ǍӍ���-+� Y�z���������ˎݎ���#��
"�0�
F�T�d�m�t�������ˏ�&�+�H�"h�����ː��(�?�K�\�
u���	����-��0ߑ+�.<�-k�0��+ʒ.��-%�0S�+��.��-ߓ0
�+>�.j�����ǔޔ���3� P�	q�{�����•Ǖ	Ε*ؕ��,�	L�V�\�b�x���������ǖޖ����4�=�O�b�r�������$×%��(�#H�#l���������	Әݘ���!�=�U�q�����������ę˙���7�I�e�}�����Ț���)�=�[�u�}�����
������"�����)�5�L�^�!s�����Ü#ߜ'�+�;�T�]�8v�!��ѝ	��4�6�K�D^�
������`О71�i�p�����
����ɟ�����9�I�_�h�x� ���� Ӡ#�!�(:� c�+��%��֡����'+�S�c�x���%��)͢
����0�
L�W�	q�
{�&��!�� ңP�"D�%g�%��"��&֤���4�Q�m���	����)���"��""�E�V�\�w���������Ϧ)Ԧ���(�>�Y�o��� ����ҧ ��&%�"L�)o�����"Ũ��	��	#�-�@�R�k�~�������é*ک'�-�I�$f�$��#��
Ԫ������+�#2�#V�=z�M��#�M*�^x�׬�	�%!�G�_�	u������#�����
�&�K/�&{�&��ɮ1���'�
-�;�
D�R�"p�
������
��!�������"�.�4�D�Y�`�{��� ����Ȱܰ����"�,2�4_�����Ʊֱ���
6�A�U�(q�,��Dz!�!�'�<�$S�$x�����˳�����9�L�	b�l���a��!�%&�
L�W�r�����	����aѵ3�<� O�p�������
ζٶ��

��-�I�"h�!����!��"�#�*�A�(\��� ����θ����4�O�k�������+ع�
�&�
8�C�U�g�������
��úܺ&�#�/�?�W� p� ����0û�$�-�9E����������ؼ߼���*�1�#A�e�{�	������̽Խ�,��!+� M�$n�&����ξ����7#�[�{�������ҿ���*�B�X�n������������0�J�R�f�w�����������#�;�B�	T�^�u�{�����-��(���"'�$J�o�����������������%��k�^�������#�;�O�c�w�������������������)�B�_�.|�*������	����/�F�Y�n���!��2������*�?�N�c�&s�+�����������
�
(�3�H�\�q���6��G��(�	C�M�_�e�u�{�&��K��e��u[�o��JA�o��J��G�J�M�Q�V�\�a�d�h�l�o�r�v�y�|������������������������������������������������������������������������ �#�'�*�-�0�7�:�=�@�D�G�J�M�P�S�V�Z�]�`�c�f�i�l�o�r�u�x�{�~����������������������������������������������������������������������������	�����������-�K�a����0�������'�+�G�_�$u�$����
��	����
�-�=�Q�X�]�f�w�X��2���2�1P�*��������
��	����
��
�$�?�E�\�r�1��������(���2�K� ^�=���
��������(
�3�
H�V�]�v���������+��
��/*�.Z�.����%��	�������&�/�	E�O�[�	d�
n�	y�+��	��t��.�
6�A�(T�}����������
��.�A�\�c�v�����
��������	��5�R�-q�#��#��)���	+�5�$D� i�!��������.��L!�:n���&����'���'�8�@�R� l���������$�����&�
A�TL�R��J��?�%T�z���H��D��Q?�^��Y��qJ�&���������8�O�f�������������
�������
,�7�L�c�v��������������3�P�p�����
������ ��&�8F�,�
��������������'�A�#V�z�����"�������G8���������&�������*�G�L� ^����������������/�8�M�
e�s���,��0��'���#�<�P�f�x���$��C��=�0C�*t�������������)�F�c�������������,�>�P�f�s�����(�������2�%R�x�����������.	�48�%m���*����'��!�=3�q���	������������)�?�K�g�	s�	}�	��	��������������$��"�(*�&S�z���������
�� �4�K�e�z�*��+����*%� P�q�z������������#�!>�,`�����������!&�'H�p�$��
������#���2:�m�������%������3.�b�z���&������
�#�:�O�b�|�������&���'	�1�
C�
Q�_�n���(���������'�;�!Z�"|�'��
�
�����/�5M�#������������+�4�%=�
c�q�
��������"����!1&Sz�"���:Zw���
��	��4:61q7�4�:1K7}4�:�1%7W4�:�1�71i������ )	JTg$}��	�-���	2<	EOiq������!�	.8K_p���*�+�	$7	(\	(�	�	 �	�	�	�	


0
*D
o
�
�
�
�
�
�
�
#0Gb}�����-Iaq�����
����
%
>

Z
e
{
�
%�
�
�
�
%(6_#n�#�N�-@
]kF���Z^n#{��J&
q�����#4KXkt� �� �#!$)F p+�+���-'>fv��%�)�
5Ien	�
�-�(�'�h#)�.�+�),;%h$�&�%�	7A)U(��(����6;Jcr,x���"�6S f�� ��&�")6`z"�������'8M\kx-�/��
&,,S$�
�������--3Baa�!I([r'�� -* X p 
� � � � *� � !+!K!WS!0�!0�!3
"@A"�"�"�"
�"�"�" �"3�"# #&#
7#!B#d#w#�#�#�#�#�#�#�#�#$$ $,1$^$r$z$�$�$�$4�$>%'D%l%�%�%!�%�%!�%
&&$&)A&-k&�&"�&(�&''*.'$Y'~'�'�'�'�'(("(5(K("W('z(��(-(),V)�)#�)�)�)�)�)"	*�,*�*�*&�*�*+#+=+
O+Z+`+s+�+�+�+�+!�+,$,!6,X,"x,�,�,-�,�,---C-_-q-�-�-�-�-�-(.;.*U.�.
�.�.�.�.�.�.//'/
0/>/^/&d/(�/�/�/�/�/%0802G0z0/�0�0;�01	'111I1R1r1y1�1�12�1�1*�12"/2R2Z2g2�2�2�2-�2#�2"3(23.[3�3�3�3�3�3@4A4a4x4�4�4�4�4�4.505F5c5z5�5�5�5'�5'�5%"6H6g6o6�6�6�6�6�6�6�67&*7Q7i7r7	�7�7�7�7�7�7.�7%)8O8#d8%�8�8�8�8�8�8
�89989+L9�x9x::�:�:�:�:�:�:;;.;5;<;
K;V;i; ;�;�;�;�;�;4
<0B<s<z<�<�<�<�<�<�<	=!=&==<d=�=�=�=�=�=�=>4">?W>�>�>�>�>�>�>
�>
??5?J?Z?>t?H�?)�?	&@0@B@H@X@_@(f@L�@a�@u>Ar�AO'BrwBN�B9C<C?CCCHCNCSCVCZC^CaCdChCkCnCqCuCxC{C~C�C�C�C
�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�C�CDD	DDDDDDDD"D%D(D+D2D5D8D;D?DBDEDHDKDNDQDUDXD[D^DaDdDgDjDmDpDsDvDyD|DD�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�DEEE
EEEE�|�,��w�Q�Q.��g&�q�j�����U �w��{-	x����B�M�;�zDaH;���I��VdpN������~��"7�c(UR��<#���C[��Y�\�]?8�Z���_ll�����T7`�$R��G��g��J5D�:j�k�[@LAp�_3q���U�6���8ewu[�xyA��o��0r��L%����X�B��
 �����<E��
zH���M�W�<�O�h������^y#F*���Mxcqd= ��S��,9@�����O���|S���i!m����V�9�b&\�Gn�X�t�$��ar������
�DD����;?)M�v^����>{�/n>�M�~�.�|%�%����m�h9���
6�*�P��q�$f?�V6--����&������Z�����j������[��
�#2n]:��i�8�'��\�`�f��%�
>�i���0;'�x%^����������=La���&�Kc}�0���J �-��zahu G��r����"���ee��TCJz3���Y�������.y���z�C��:}o��*�J��('��~���Z�^�=E���q��e����vWC�!�+�Pg����3IY�v�~X@���wG5<��m*�d��)A��`���jy��SA�=�:����64�1�1u����4�?���Rk�=+�@�Y���7�)����n���DsSKs5U�N\8��rl����H�����s���-��3�42���7�"1h�')���0���t&��b�n5k1p��v����N"K���9�/��"��o���o/����{!���L�Em��U
��fS�T��V�g
oB��J`�>�I/2�������V6si3����F�kEpP2r���a���@�A��f���N���e,.b�!��*K]�:s��f��x�����C��]/T(��B�1�0�.������Lwdh7��W]���Q��(���E�}Wl2�+�t�t�;���+�W>R�_(��+�b�,���O���_
�`�����4���cv���	}�	NOPY�k?����<!F�j���H8�5�#��mT�G�u|���[B�y{��KFZ�4��~$d�#���O���	9���X,����bgQiII��X�P}�lc)
��{��p������H�|F�Zu�^tR�_'\��Q��������$	3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right Win3rd level of the "&lt; &gt;" keyA user-defined custom LayoutA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL symbols (APLX unified)APL symbols (Dyalog APL)APL symbols (IBM APL2)APL symbols (Manugistics APL*PLUS II)APL symbols (SAX, Sharp APL for Unix)APL symbols (unified)Acer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Albanian (Veqilharxhi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt and Win behaviorAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium emulates Pause, PrtSc, Scroll LockApple laptopArabicArabic (AZERTY)Arabic (AZERTY, Eastern Arabic numerals)Arabic (Algeria)Arabic (Arabic numerals, extensions in the 4th level)Arabic (Buckwalter)Arabic (Eastern Arabic numerals)Arabic (Eastern Arabic numerals, extensions in the 4th level)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (QWERTY, Eastern Arabic numerals)Arabic (Sun Type 6/7)Arabic (Syria)ArmenianArmenian (OLPC, phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and L)Asus laptopAt the bottom leftAt the corresponding key in a Colemak layoutAt the corresponding key in a Dvorak layoutAt the corresponding key in a QWERTY layoutAtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 Wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi InScript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Gitanjali)Bangla (India, Probhat)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (intl.)Belarusian (legacy)BelgianBelgian (ISO, alt.)Belgian (Latin-9 only, alt.)Belgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt.)Belgian (no dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh phonetic, alt.)Berber (Morocco, Tifinagh)BosnianBosnian (US)Bosnian (US, with Bosnian digraphs)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (enhanced)Bulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon (AZERTY, intl.)Cameroon (Dvorak, intl.)Cameroon Multilingual (QWERTY, intl.)Canadian (intl.)Canadian (intl., 1st part)Canadian (intl., 2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock as Ctrl, Ctrl as HyperCaps Lock behaviorCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles Shift Lock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCompatibility optionsComposeCopticCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US)Croatian (US, with Croatian digraphs)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt, Alt to WinCtrl is mapped to Right Win and the usual CtrlCtrl is mapped to Win and the usual CtrlCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCurrency signsCzechCzech (QWERTY)Czech (QWERTY, Macintosh)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (coder)Czech (programming)Czech (programming, typographic)Czech (typographic)Czech (with &lt;\|&gt; key)Czech Slovak and German (US)Czech, Slovak, Polish, Spanish, Finnish, Swedish and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Windows)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (US)Dutch (standard)DzongkhaElfdalian (Swedish, with combining ogonek)Enable APL overlay charactersEnable extra typographic charactersEnglish (3l)English (3l, Chromebook)English (3l, emacs)English (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Colemak-DH ISO)English (Colemak-DH)English (Drix)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Colemak-DH)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Macintosh, intl.)English (UK, Sun Type 6/7)English (UK, extended, Windows)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, Symbolic)English (US, alt. intl.)English (US, euro on 5)English (US, intl., AltGr Unicode combining)English (US, intl., AltGr Unicode combining, alt.)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (legacy)Esperanto letters with superscriptsEstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US)Estonian (no dead keys)EurKEY (US)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Dvorak)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Windows)Finnish (classic)Finnish (classic, no dead keys)Four-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (AZERTY, AFNOR)French (BEPO)French (BEPO, AFNOR)French (BEPO, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Togo)French (US with dead keys, alt.)French (US)French (US, AZERTY)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (no dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PCGeneric 104-key PCGeneric 104-key PC with L-shaped Enter keyGeneric 105-key PCGeneric 86-key PCGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Bone)German (Bone, eszett in the home row)German (Dvorak)German (E1)German (E2)German (KOY)German (Ladin)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo, QWERTY)German (Neo, QWERTZ)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (T3)German (US)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters, no dead keys)German, Swedish and Finnish (US)GreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHanyu Pinyin (with AltGr dead keys)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HawaiianHebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa, phonetic)Hindi (Wx)Honeywell EuroboardHungarianHungarian (QWERTY)Hungarian (QWERTY, 101-key, comma, dead keys)Hungarian (QWERTY, 101-key, comma, no dead keys)Hungarian (QWERTY, 101-key, dot, dead keys)Hungarian (QWERTY, 101-key, dot, no dead keys)Hungarian (QWERTY, 102-key, comma, dead keys)Hungarian (QWERTY, 102-key, comma, no dead keys)Hungarian (QWERTY, 102-key, dot, dead keys)Hungarian (QWERTY, 102-key, dot, no dead keys)Hungarian (QWERTZ, 101-key, comma, dead keys)Hungarian (QWERTZ, 101-key, comma, no dead keys)Hungarian (QWERTZ, 101-key, dot, dead keys)Hungarian (QWERTZ, 101-key, dot, no dead keys)Hungarian (QWERTZ, 102-key, comma, dead keys)Hungarian (QWERTZ, 102-key, comma, no dead keys)Hungarian (QWERTZ, 102-key, dot, dead keys)Hungarian (QWERTZ, 102-key, dot, no dead keys)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)IgboIndianIndic IPAIndonesian (Arab Pegon, extended phonetic)Indonesian (Javanese)Indonesian (Latin)International Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (Dvorak)Italian (IBM 142)Italian (Ladin)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US)Italian (Windows)Italian (intl., with dead keys)Italian (no dead keys)JapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7, PC-compatible)Japanese (Sun Type 7, Sun-compatible)Japanese keyboard optionsKabyle (AZERTY, with dead keys)Kabyle (QWERTY, UK, with dead keys)Kabyle (QWERTY, US, with dead keys)KalmykKana Lock key is lockingKannadaKannada (KaGaPa, phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 2nd levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104-key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA)LatvianLatvian (Colemak)Latvian (Colemak, with apostrophe)Latvian (Dvorak)Latvian (Dvorak, with Y)Latvian (Dvorak, with minus)Latvian (F)Latvian (Sun Type 6/7)Latvian (adapted)Latvian (apostrophe)Latvian (apostrophe, dead quotes)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer Dvorak)Latvian (programmer Dvorak, with Y)Latvian (programmer Dvorak, with minus)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (Dvorak)Lithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Ratise)Lithuanian (Sun Type 6/7)Lithuanian (US)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMake Caps Lock an additional BackspaceMake Caps Lock an additional CtrlMake Caps Lock an additional EscMake Caps Lock an additional Esc, but Shift + Caps Lock is the regular Caps LockMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMake right Alt a Hangul keyMake right Alt a Hanja keyMake right Ctrl a Hangul keyMake right Ctrl a Hanja keyMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced InScript, with rupee)MalteseMaltese (UK, with AltGr overrides)Maltese (US)Maltese (US, with AltGr overrides)Manipuri (Eeyek)MaoriMarathi (KaGaPa, phonetic)Marathi (enhanced InScript)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMenu chooses 5th levelMenu is mapped to WinMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AMmuockModi (KaGaPa phonetic)MoldavianMoldavian (Gagauz)MongolianMongolian (Bichig)Mongolian (Galik)Mongolian (Manchu Galik)Mongolian (Manchu)Mongolian (Todo Galik)Mongolian (Todo)Mongolian (Xibe)MontenegrinMontenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Cyrillic, with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Montenegrin (Latin, with guillemets)Multilingual (Canada, Sun Type 6/7)N'Ko (AZERTY)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Non-breaking space inputNorthern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Windows)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrows. Num Lock off: arrows (as in Windows)Number key 4 when pressed in isolationNumber key 9 when pressed in isolationNumeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOld Hungarian (for ligatures)Old Solaris keycodes compatibilityOld TurkicOriyaOriya (Bolnagri)Oriya (Wx)Ortek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Windows)Ossetian (legacy)OttomanOttoman (F)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)Phone and ATM stylePolishPolish (British keyboard)Polish (Colemak)Polish (Colemak-DH)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Colemak)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th levelRight Alt chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Windows)Romanian (ergonomic Touchtype)Romanian (standard)Rupee on 4RussianRussian (Belarus)Russian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic Macintosh)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, Windows)Russian (phonetic, YAZHERTY)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)SamogitianSamsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa, phonetic)Sanskrit symbolsSanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic, ZE and ZHE swapped)Serbian (Cyrillic, with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Latin, with guillemets)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US)Sinhala (phonetic)SlovakSlovak (ACC layout, only accented letters)Slovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Windows)Spanish (dead tilde)Spanish (no dead keys)Special keys (Ctrl+Alt+&lt;key&gt;) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Sun key compatibilitySuper Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap Esc and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Dvorak, intl.)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (InScript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa, phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)The "&lt; &gt;" keyThe "&lt; &gt;" key chooses 5th levelThe "&lt; &gt;" key chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserThe "&lt; &gt;" key; acts as onetime lock when pressed together with another 3rd level chooserTibetanTibetan (with ASCII numerals)To the left of "A"Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Windows)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode arrows and math operatorsUnicode arrows and math operators on default levelUnitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Windows)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to indicate modifiersUse keyboard LED to show alternative layoutUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French)Vietnamese (QĐERTY)Vietnamese (US)ViewSonic KU-306 InternetWang 724 keypad with Unicode arrows and math operatorsWang 724 keypad with Unicode arrows and math operators on default levelWin is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcscustomdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunoldhun(lig)orpaphplpsptrorusasassatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config-2.32.99
Report-Msgid-Bugs-To: svu@users.sourceforge.net
PO-Revision-Date: 2021-05-23 12:19+0200
Last-Translator: Fabio Tomat <f.t.public@gmail.com>
Language-Team: Friulian <f.t.public@gmail.com>
Language: fur
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
X-Generator: Poedit 2.4.3
Plural-Forms: nplurals=2; plural=(n != 1);
Tierç nivel dal BlocMaiuscTierç nivel dal Ctrl a çampeTierç nivel dal Win a çampeTierç nivel di MenùTierç nivel dal Ctrl diestriTierç nivel dal Win diestri3ᶜ nivel dal tast "&lt; &gt;"Une disposizion personalizade definide dal utentA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSimbui APL (APLX unificade)Simbui APL (APL Dyalog)Simbui APL (IBM APL2)Simbui APL (Manugistics APL*PLUS II)Simbui APL (SAX, APL Sharp par Unix)Simbui APL (unificâts)Acer AirKey VAcer C300Acer Ferrari 4000Portatil AcerZonte il compuartament standard al tast MenùAdvance Scorpius KIAfganeAkanAlbaneseAlbanese (Plisi)Albanês (Veqilharxhi)Permet di interompi la cature cun lis azions di tastiere (atenzion: pericul di sigurece)Permet di caturâ e regjistrâ l'arbul dai barconsAlt e Meta a son su AltCompuartament tascj Alt e WinAlt al è aplicât al Win diestri, Super al MenùAlt al è aplicât a Win e ai Alt abituâiAlt al è scambiât cun WinAlt+BlocMaiuscAlt+CtrlAlt+MaiuscAlt+SpaziAmharicCualsisei AltCualsisei WinCualsisei Win (intant che si frache)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium al emule Pause, Stampe e BlocScorPortatil AppleArabeArabe (AZERTY)Arabe (AZERTY, cifris arabis orientâls)Arabe (Algjerie)Arabe (cifris arabis, estensions intal 4ᵗ nivel)Arabe (Buckwalter)Arabe (cifris arabis orientâls)Arabe (cifris arabis orientâls, estensions intal 4ᵗ nivel)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (QWERTY)Arabe (QWERTY, cifris arabis orientâls)Arabe (Sun Type 6/7)Arabe (Sirie)ArmeneArmene (OLPC, fonetiche)Armene (alt. orientâl)Armene (alt. fonetiche)Armene (orientâl)Armene (fonetiche)Armene (ocidentâl)Asturiane (Spagne, H e L cun pont sotscrit)Portatil AsusIn bas a çampeAl tast corispondent intune disposizion ColemakAl tast corispondent intune disposizion DvorakAl tast corispondent intune disposizion QWERTYAtsinaFrancese (vecje maniere, alternative)AvesticheAzereAzere (ciriliche)Azona RF2300 Wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashSbare invierse; cuant che e ven fracade adun cuntun altri seletôr di tierç nivel, e agjìs come bloc par une volteBambaraBangladeshBangladesh (Indie)Bangladesh (Indie, inscrizion Baishakhi)Bangladesh (Indie, Baishakhi)Bangladesh (Indie, Bornona)Bangladesh (Indie, Gitanjali)Bangladesh (Indie, Probhat)Bangladesh (Probhat)BaschireBielorusseBielorusse (latine)Bielorusse (intl.)Bielorusse (vecje maniere)BelgheBelghe (ISO, alt.)Belghe (dome latin-9, alt.)Belghe (Sun Type 6/7)Belghe (Wang 724 AZERTY)Belghe (alt.)Belghe (cence tascj muarts)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbare (Algjerie, latine)Berbare (Algjerie, Tifinagh)Berbare (Maroc, alt. Tifinagh)Berbare (Maroc, Tifinagh fonetiche slargjade)Berbare (Maroc, Tifinagh slargjade)Berbare (Maroc, fonetiche Tifinagh)Berbare (Maroc, fonetiche Tifinagh, alt.)Berbare (Maroc, Tifinagh)BosgnacheBosgnache (US)Bosgnache (US, cun digrafs bosgnacs)Bosgnache (cun digrafs bosgnacs)Bosgnache (cun virgulutis bassis)Ducj i doi i Alt adunDucj i doi i Ctrl adunDucj i doi i Maiusc adunDucj i doi i Maiusc adun a abilitin BlocMaiuscDucj i doi i Maiusc adun a abilitin BlocMaiusc; un tast Maiusc lu disabiliteDucj i doi i Maiusc adun a abilitin il stât di BlocMaiuscBrailleBraille (çampine poleârs invertîts)Braille (çampine)Braille (man drete poleârs invertîts)Braille (man drete)Brother InternetBulgareBulgare (miorade)Bulgare (fonetiche gnove)Bulgare (fonetiche tradizionâl)BirmaneBirmane ZawgyiCamerun (AZERTY, intl.)Cameroon (Dvorak, intl.)Camerun plurilengâl (QWERTY, intl.)Canadese (intl.)Canadese (intl., 1ⁿ toc)Canadese (intl., 2ᵗ toc)BlocMaiuscBlocMaiusc (intant che si frache), Alt+BlocMaiusc pe azion origjinarie di BlocMaiuscBlocMaiusc al agjìs come Maiusc cul bloc; Maiusc al met in “pause” BlocMaiuscBlocMaiusc al agjìs come Maiusc cul bloc; Maiusc nol influence BlocMaiuscBlocMaiusc come CtrlBlocMaiusc come Ctrl, Ctrl come HyperCompuartament BlocMaiuscBlocMaiusc al è disabilitâtBlocMaiusc ae prime disposizion; Maiusc+BlocMaiusc ae ultime disposizionBlocMaiusc al comute il Bloc di Maiusc (al à efiet su ducj i tascj)BlocMaiusc al comute l'ûs normâl des letaris maiusculis dai caratars alfabeticsBlocMaiusc al fâs ûs interni des letaris maiusculis. Maiusc al met in “pause” BlocMaiuscBlocMaiusc al fâs ûs des letaris maiusculis internis; Maiusc nol à efiet su BlocMaiuscBlocMaiusc; al agjìs come bloc par une volte sole cuant che si frache adun cuntun altri seletôr di tierç nivelCatalane (Spagne, cun L cun pont medi)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420CineseChromebookSlâf eclesiasticChuvashChuvash (latine)Classmate PCCloGaelachCoeur d'Alene SalishPortatil Compaq ArmadaCompaq Easy AccessCompaq Internet (13 tascj)Compaq Internet (18 tascj)Compaq Internet (7 tascj)Portatil Compaq PresarioCompaq iPaqOpzions di compatibilitâtComposeCopteCreative Desktop Wireless 7000Tatare de Crimee (Dobruze Q)Tatare de Crimee (Alt-Q Turche)Tatare de Crimee (F Turche)Tatare de Crimee (Q Turche)CravuateCravuate (US)Cravuate (cun digrafs cravuats)Cravuate (cun digafs cravuats)Cravuate (cun virgulutis bassis)Ctrl al è aplicât ai Alt, Alt ai WinCtrl al è aplicât al Win di diestre e ai Ctrl abituâiCtrl al è aplicât ai Win e i Ctrl abituâiPosizion CtrlCtrl+Alt+BackspaceCtrl+MaiuscSimbui di valudeCecheCeche (QWERTY)Ceche (QWERTY, Macintosh)Ceche (QWERTY, sbare invierse complete)Ceche (Sun Type 6/7)Ceche (UCW, nome letaris acentadis)Ceche (US, Dvorak, supuart UCW)Ceche (codificadôr)Ceche (programazion)Ceche (programazion, tipografiche)Ceche (tipografiche)Ceche (cun tascj &lt;\|&gt;)Ceche Slovache e Todescje (US)Ceche, Slovache, Polache, Spagnole, Finlandese, Svedese e Todescje (US)DTK2000DaneseDanese (Dvorak)Danese (Macintosh)Danese (Macintosh, cence tascj muarts)Danese (Sun Type 6/7)Danese (Windows)Danese (cence tascj muarts)Tascj predefinîts de tastierute numericheDellDell 101-tascj PCPortatil Dell Inspiron 6000/8000Portatil Dell LatitudePortatil Dell Precision M65Portatil Dell Precision M65Dell SK-8125Dell SK-8135Dell USB multimediâlDexxa Wireless DesktopDhivehiDiamond 9801/9802OlandeseOlandese (Macintosh)Olandese (Sun Type 6/7)Olandese (US)Olandese (standard)DzongkhaElfdaliane (Svedese, cun combinazion ogonek)Abilite caratars APL tipografics in soreposizionAbilite caratars tipografics adizionâiInglese (3l)Inglese (3l, Chromebook)Inglese (3l, emacs)Inglese (Australiane)Inglese (Camerun)Inglese (Canadà)Inglese (Carpalx)Inglese (Carpalx, otimizazion plene)Inglese (Carpalx, otimizazion plene, intl., cun tascj muarts AltGr)Inglese (Carpalx, otimizazion plene, intl., cun tascj muarts)Inglese (Carpalx, intl., cun tascj muarts AltGr)Inglese (Carpalx, intl., cun tascj muarts)Inglese (Colemak)Inglese (Colemak-DH ISO)Inglese (Colemak-DH)Inglese (Drix)Inglese (Dvorak)Inglese (Dvorak, alt. intl.)Inglese (Dvorak, intl. ,cun tascj muarts)Inglese (Dvorak, man çampe)Inglese (Dvorak, man drete)Inglese (Ghana)Inglese (Ghana, GILLBT)Inglese (Ghana, plurilengâl)Inglese (Indie, cun rupie)Inglese (Macintosh)Inglese (Mali, US, Macintosh)Inglese (Mali, US, intl.)Inglese (Nigerie)Inglese (Normane)Inglese (Sud Afriche)Inglese (UK)Inglese (UK, Colemak)Inglese (UK, Colemak-DH)Inglese (UK, Dvorak)Inglese (UK, Dvorak, cun puntuazions UK)Inglese (UK, Macintosh)Inglese (UK, Macintosh, intl.)Inglese (UK, Sun Type 6/7)Inglese (UK, complete, Windows)Inglese (UK, intl., cun tascj muarts)Inglese (US)Inglese (US, IBM Arabe 238_L)Inglese (US, Sun Type 6/7)Inglese (US, simboliche)Inglese (UK, alt. intl.)Inglese (US, euro sul 5)Inglese (US, intl., cumbinazion AltGr Unicode)Inglese (US, intl., cumbinazion AltGr Unicode, alt.)Inglese (US, intl., cun tascj muarts)Inglese (operari)Inglese (operari, intl., cun tascj muarts)Inglese (Dvorak classic)Inglese (intl., cun tascj muarts AltGr)Inglese (Dvorak par programadôr)Inglese (i tascj divît/moltipliche a cambiin la disposizion)Ennyah DKB-1008Invie su la tastieruteEsperantoEsperanto (Brasîl, natîf)Esperanto (Portugal, natîf)Esperanto (vecje maniere)Letaris Esperanto cun apiçsEstoneEstone (Dvorak)Estone (Sun Type 6/7)Estone (US)Estone (cence tascj muarts)EurKEY (US)Euro su 2Euro su 4Euro su 5Euro su EEverex STEPnoteEweFL90FaroeseFaroese (cence tascj muarts)FilipineFilipine (Capewell-Dvorak, Baybayin)Filipine (Capewell-Dvorak, Latine)Filipine (Capewell-QWERF 2006, Baybayin)Filipine (Capewell-QWERF 2006, Latine)Filipine (Colemak, Baybayin)Filipine (Colemak, Latine)Filipine (Dvorak, Baybayin)Filipine (Dvorak, Latine)Filipine (QWERTY, Baybayin)FinlandeseFinlandese (DAS)Finlandese (Dvorak)Finlandese (Macintosh)Finlandese (Sun Type 6/7)Finlandese (Windows)Finlandese (classiche)Finlandese (classiche, cence tascj muarts)Tast di cuart nivel cun separadôrs astratsTast di cuart nivel cun virguleTast di cuart nivel cun pontTast di cuart nivel cun pont, dome Latin-9Tast di cuart nivel cun momayyezFranceseFrancese (AZERTY)Francese (AZERTY, AFNOR)Francese (BEPO)Francese (BEPO, AFNOR)Francese (BEPO, dome latin-9)Francese (Bretone)Francese (Camerun)Francese (Canadà)Francese (Canadà, Dvorak)Francese (Canadà, vecje maniere)Francese (Republiche democratiche dal Congo)Francese (Dvorak)Francese (Macintosh)Francese (Mali, alt.)Francese (Maroc)Francese (Sun Type 6/7)Francese (Svuizare)Francese (Svuizare, Macintosh)Francese (Svuizare, Sun Type 6/7)Francese (Svuizare, cence tascj muarts)Francese (Togo)Francese (US cun tascj muarts, alt.)Francese (US)Francese (US, AZERTY)Francese (alt.)Francese (alt., dome latin-9)Francese (alt., cence tascj muarts)Francese (vecje maniere, alt.)Francese (vecje maniere, alt., cence tascj muarts)Francese (cence tascj muarts)Furlane (Italie)Portatil Amilo Fujitsu-SiemensFulaFrancese (vecje maniere, alternative)Gjeneriche 101-tascj PCGjeneriche 102-tascj PCGjeneriche 104-tascj PCGjeneriche 104-tascj PC cun tast Invie a forme di LGjeneriche 105-tascj PCGjeneriche 86-tascj PCGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGjeorgjianeGjeorgjiane (France, AZERTY Tskapo)Gjeorgjiane (Italie)Gjeorgjiane (MESS)Gjeorgjiane (ergonomiche)TodescjeTodescje (Aus der Neo-Welt)Todescje (Austrie)Todescje (Austrie, Macintosh)Todescje (Austrie, cence tascj muarts)Todescje (Bone)Todescje (Bone, te rie di inizi eszett)Todescje (Dvorak)Todescje (E1)Todescje (E2)Todescje (KOY)Todescje (ladine)Todescje (Macintosh)Todescje (Macintosh, cence tascj muarts)Todescje (Neo 2)Todescje (Neo, QWERTY)Todescje (Neo, QWERTZ)Todescje (QWERTY)Todescje (Sun Type 6/7)Todescje (Svuizare)Todescje (Svuizare, Macintosh)Todescje (Svuizare, Sun Type 6/7)Todescje (Svuizare, vecje maniere)Todescje (Svuizare, cence tascj muarts)Todescje (T3)Todescje (US)Todescje (acût muart)Todescje (acût grâf muart)Todescje (tilde muarte)Todescje (cence tascj muarts)Todescje (cun letaris Ongjaresis, cence tascj muarts)Todescje, svedese e finlandese (US)GrecheGreche (Colemak)Greche (Sun Type 6/7)Greche (slargjade)Greche (cence tascj muarts)Greche (politoniche)Greche (semplice)GujaratiGyrationHanyu Pinyin (cun tascj muarts AltGr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigerie)HawaianeEbraicheEbraiche (Bibliche, SIL fonetiche)Ebraiche (bibliche, Tiro)Ebraiche (lyx)Ebraiche (fonetiche)Hewlett-Packard InternetPortatil Hewlett-Packard Mini 110Hewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020EsadecimâlHindi (Bolnagri)Hindi (KaGaPa, fonetiche)Hindi (Wx)Honeywell EuroboardOngjareseOngjarese (QWERTY)Ongjarese (QWERTY, 101 tascj, virgule, tascj muarts)Ongjarese (QWERTY, 101 tascj, virgule, cence tascj muarts)Ongjarese (QWERTY, 101 tascj, pont, tascj muarts)Ongjarese (QWERTY, 101 tascj, pont, cence tascj muarts)Ongjarese (QWERTY, 102 tascj, virgule, tascj muarts)Ongjarese (QWERTY, 102 tascj, virgule, cence tascj muarts)Ongjarese (QWERTY, 102 tascj, pont, tascj muarts)Ongjarese (QWERTY, 102 tascj, pont, cence tascj muarts)Ongjarese (QWERTZ, 101 tascj, virgule, tascj muarts)Ongjarese (QWERTZ, 101 tascj, virgule, cence tascj muarts)Ongjarese (QWERTZ, 101 tascj, pont, tascj muarts)Ongjarese (QWERTZ, 101 tascj, pont, cence tascj muarts)Ongjarese (QWERTZ, 102 tascj, virgule, tascj muarts)Ongjarese (QWERTZ, 102 tascj, virgule, cence tascj muarts)Ongjarese (QWERTZ, 102 tascj, pont, tascj muarts)Ongjarese (QWERTZ, 102 tascj, pont, cence tascj muarts)Ongjarese (cun tascj muarts)Ongjarese (standard)Hyper al è aplicât ai WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandeseIslandese (Dvorak)Islandese (Macintosh)Islandese (Macintosh, vecje maniere)IgboIndianeIndic IPAIndonesiane (arabe Pegon, fonetiche complete)Indonesiane (Javanese)Indonesiane (Latine)Alfabet fonetic internazionâlInuktitutIrakianeIrlandeseIrlandese (UnicodeEspert)TalianeTaliane (Dvorak)Taliane (IBM 142)Taliane (Ladine)Taliane (Macintosh)Taliane (Sun Type 6/7)Taliane (US)Taliane (Windows)Taliane (intl., cun tascj muarts)Taliane (cence tascj muarts)GjaponeseGjaponese (Dvorak)Gjaponese (Kana 86)Gjaponese (Kana)Gjaponese (Macintosh)Gjaponese (OADG 109A)Gjaponese (PC-98)Gjaponese (Sun Type 6)Gjaponese (Sun Type 7, compatibile cun pc)Gjaponese (Sun Type 7, compatibile cun Sun)Opzions tastiere gjaponeseCabiliane (AZERTY, cun tascj muarts)Cabiliane (QWERTY, UK, cun tascj muarts)Cabiliane (QWERTY, US, cun tascj muarts)KalmykIl tast Kana Lock al sta blocantKannadaKannada (KaGaPa, fonetiche)CassubieKazakheKazache (Latine)Kazakhe (slargjade)Kazakhe (cun russe)Secuence di tascj par copâ il servidôr XTast par sielzi il cuint nivelTast par sielzi il secont nivelTast par sielzi il tierç nivelKeytronic FlexProKhmer (Camboze)KikuyuKinesisKomiCoreaneCoreane (compatibile 101/104 tascj)Coreane (Sun Type 6/7)Tascj Hangul/Hanja coreansCurde (Iran, arabe-latine)Curde (Iran, F)Curde (Iran, latine Alt-Q)Curde (Iran, latine Q)Curde (Irak, arabe-latine)Curde (Irak, F)Curde (Irak, latine Alt-Q)Curde (Irak, latine Q)Curde (Sirie, F)Curde (Sirie, latine Alt-Q)Curde (Sirie, latine Q)Curde (Iran, F)Curde (Turchie, latine Alt-Q)Curde (Turchie, latine Q)KutenaiKirghizeKirghize (fonetiche)LaoLao (STEA)LetoneLetone (Colemak)Letone (Colemak, cun apostrof)Letone (Dvorak)Letone (Dvorak, cu la Y)Letone (Dvorak, cul mancul)Letone (F)Letone (Sun Type 6/7)Letone (adatade)Letone (apostrof)Letone (apostrof, virgulutis muartis)Letone (ergonomiche, ŪGJRMV)Letone (moderne)Letone (programadôr Dvorak)Letone (programadôr Dvorak, cu la Y)Letone (programadôr Dvorak, cul mancul)Letone (tilde)Disposizion de tastierute numericheAlt a çampeAlt a çampe (intant che si frache)Alt a çampe come Ctrl, Ctrl a çampe come Win, Win a çampe come Alt a çampeAlt a çampe al è scambiât cun Win a çampeAlt a çampe+Maiusc a çampeCtrl a çampeMeta come Ctrl a çampeCtrl a çampe ae prime disposizion, Ctrl diestri ae ultime disposizionCtrl a çampe+Maiusc a çampeCtrl a çampe+Win a çampeCtrl a çampe+Win a çampe ae prime disposizion; Ctrl diestri+Menù ae seconde disposizionMaiusc a çampeWin a çampeWin a çampe (intant che si frache)Win di çampe al sielç il 5ᵗ nivel e al agjìs come bloc par une volte cuant che al ven fracât cuntun altri seletôr di 5ᵗ nivelWin a çampe ae prime disposizion; Win diestri/Menù ae ultime disposizionVecje maniereWang 724 vecje maniereTast vecje maniere cun virguleTast vecje maniere cun pontLituaneLituane (Dvorak)Lituane (IBM LST 1205-92)Lituane (LEKP)Lituane (LEKPa)Lituane (Ratise)Lituane (Sun Type 6/7)Lituane (US)Lituane (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2ᵉ alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTascj adizionâi Logitech G15 vie G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBSorabe inferiôrSorabe inferiôr (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedoneMacedone (cence tascj muarts)MacintoshMacintosh OldFâs deventâ BlocMaiusc un Backspace in pluiFâs deventâ BlocMaiusc un Ctrl in pluiFâs deventâ BlocMaiusc un Esc in pluiRint il Bloc Maiusc un Esc adizionâl, ma Maiusc + Bloc Maiusc si compuarte come il Bloc Maiusc regolârFâs deventâ BlocMaiusc un Hyper in pluiFâs deventâ BlocMaiusc un tast Menù in pluiFâs deventâ BlocMaiusc un BlocNum in pluiFâs deventâ BlocMaiusc un Super in pluiFâs deventâ Zenkaku Hankaku un Esc in pluiRint il Alt di diestre un tast HangulRint il Alt di diestre un tast HanjaRint il Ctrl di diestre un tast HangulRint il Ctrl di diestre un tast HanjaMalese (Jawi, tastiere arabe)Malese (Jawi, fonetiche)MalayalamMalayalam (Lalitha)Malayalam (Inscrizion miorade, cun rupie)MalteseMaltese (UK, cun soreposizions di AltGr)Maltese (US)Maltese (US, cun soreposizions di AltGr)Manipuri (Eeyek)MaoriMarathi (KaGaPa, fonetiche)Marathi (Inscrizion miorade)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenùTast Menù (fracât), Maiusc+Menù par MenùMenù come Ctrl diestriMenù al sielç il cuint nivelMenù al è aplicât ai WinMeta al è aplicât a Win a çampeMeta al è aplicât ai WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Svedese)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AMmuockModi (KaGaPa fonetiche)MoldaveMoldave (Gagauz)MonguleMongule (Bichig)Mongule (Galik)Mongule (Manchu Galik)Mongule (Manchu)Mongule (Todo Galik)Mongule (Todo)Mongule (Xibe)MontenegrineMontenegrine (Ciriliche)Montenegrine (Ciriliche, ZE e ZHE scambiadis)Montenegrine (Ciriliche, cun virgulutis bassis)Montenegrine (Latine, QWERTY)Montenegrine (Latine, Unicode)Montenegrine (Latine, Unicode, QWERTY)Montenegrine (Latine, cun virgulutis bassis)Plurilengâl (Canadà, Sun Type 6/7)N'Ko (AZERTY)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Backspace stîl NICOLA-FNepaleseCaratar di spazi no separabil al secont nivelCaratar di spazi no separabil al tierç nivelCaratar di spazi no separabil al tierç nivel, nuie al cuart nivelCaratar di spazi no separabil al tierç nivel, caratar di spazi stret no separabil al cuart nivelSpazi no separabil al cuart nivelSpazi no separabil al cuart nivel, spazi stret no separabil al sest nivelSpazi no separabil al cuart nivel, spazi stret no separabil al sest nivel (vie Ctrl+Maiusc)Inserzion caratar di spazi no separabilSaami dal nord (Finlande)Saami dal nord (Norvegje)Saami dal nord (Norvegje, cence tascj muarts)Saami dal nord (Svezie)Northgate OmniKey 101NorvegjeseNorvegjese (Colemak)Norvegjese (Dvorak)Norvegjese (Macintosh)Norvegjese (Macintosh, cence tascj muarts)Norvegjese (Sun Type 6/7)Norvegjese (Windows)Norvegjese (cence tascj muarts)BlocNumBlocNum impiât: cifris; Maiusc pes frecis. BlocNum distudât: frecis (come in Windows)Tast numar 4 cuant che al ven fracât di bessôlTast numar 9 cuant che al ven fracât di bessôlCompuartament dal tast canc de tastierute numericheLa tastierute numeriche e inserìs simpri cifris (come in macOS)OLPCOcitaneOghamOgham (IS434)Ol ChikiOngjarese vecjeOngjarese antighe (pes leaduris)Compatibilitât codiçs dai tascj dal vecjo SolarisTurche antigheOriyaOriya (Bolnagri)Oriya (Wx)Ortek Multimedia/Internet MCK-800Ossete (Gjeorgjie)Ossete (Windows)Ossete (vecje maniere)OtomaneOtomane (F)PC-98Rutenie pannonichePosizion parentesisPashtoPashto (Afganistan, OLPC)PausePersianePersiane (Afganistan, Dari OLPC)Persiane (cun tastierute numeriche persiane)Stîl telefon e ATMPolachePolache (tastiere britaniche)Polache (Colemak)Polache (Colemak-DH)Polache (Dvorak)Polache (Dvorak, cun virgulutis polachis sul tast 1)Polache (Dvorak, cun virgulutis polachis sul tast di citazion)Polache (Gjermanie, cence tascj muarts)Polache (Glagolica)Polache (QWERTZ)Polache (Sun Type 6/7)Polache (intl., cun tascj muarts)Polache (vecje maniere)Polache (Dvorak par programadôr)PortughesePortughese (Brasîl)Portughese (Brasîl, Dvorak)Portughese (Brasîl, IBM/Lenovo ThinkPad)Portughese (Brasîl, natîf par tastieris US)Portughese (Brasîl, natîf)Portughese (Brasîl, Sun Type 6/7)Portughese (Brasîl, cence tascj muarts)Portughese (Colemak)Portughese (Macintosh)Portughese (Macintosh, cence tascj muarts)Portughese (natîf par tastieris US)Portughese (natîf)Portughese (Sun Type 6/7)Portughese (cence tascj muarts)Posizion dal tast ComponiPropeller Voyager KTEZ-1000StampPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Alt diestriAlt diestri (intant che si frache)Il Alt diestri al sielç il cuint nivelAlt diestri al sielç il 5ᵗ nivel e cuant che al ven fracât cuntun altri seletôr di 5ᵗ nivel, al agjìs come bloc par une volteIl Alt diestri nol sielç mai il tierç nivelAlt diestri, Maiusc+Alt diestri come ComponiCtrl diestriCtrl diestri (intant che si frache)Ctrl diestri come Alt diestriCtrl diestri+Maiusc diestriMaiusc diestriWin diestriWin diestri (intant che si frache)Win diestri al sielç il 5ᵗ nivel e al agjìs come bloc par une volte cuant che al ven fracât cuntun altri seletôr di 5ᵗ nivelRumeneRumene (Gjermanie)Rumene (Gjermanie, cence tascj muarts)Rumene (Sun Type 6/7)Rumene (Windows)Rumene (gjenar di contat ergonomic)Rumene (standard)Rupie su 4RusseRusse (Bielorusse)Russe (Ceche, fonetiche)Russe (DOS)Russe (Gjeorgjie)Russe (Gjermanie, fonetiche)Russe (Gjermanie, conseade)Russe (Gjermanie, trasliterazion)Russe (Kazakhstan, cun Kazakh)Russe (Macintosh)Russe (Polonie, fonetiche Dvorak)Russe (Poliglote e reazionarie)Russe (Rulemak, fonetiche Colemak)Russe (Sun Type 6/7)Russe (Svezie, fonetiche)Russe (Svezie, fonetiche, cence tascj muarts)Russe (US, fonetiche)Russe (Ucraine, standard RSTU)Russe (vecje maniere)Russe (fonetiche Macintosh)Russe (fonetiche)Russe (fonetiche, AZERTY)Russe (fonetiche, Dvorak)Russe (fonetiche, francese)Russe (fonetiche, Windows)Russe (fonetiche, YAZHERTY)Russe (machine di scrivi)Russe (machine di scrivi, vecje maniere)Russe (cun puntuazion US)Russe (cun disposizion Ucraine-Bielorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)SamoghitianeSamsung SDM 4500PSamsung SDM 4510PSanscrit (KaGaPa, fonetiche)Simbui sanscritSanwa Supply SKB-KG3BlocScorSecwepemctsinPont e virgule sul tierç nivelSerbeSerbe (Ciriliche, ZE e ZHE scambiadis)Serbe (Ciriliche, cun virgulutis bassis)Serbe (latine)Serbe (latine, QWERTY)Serbe (latine, Unicode)Serbe (latine, Unicode, QWERTY)Serbe (Latine, cun virgulutis bassis)Serbe (Russie)Serbe (cumbinazion acents invezit di tascj muarts)Serbe-Cravuate (US)Maiusc + BlocNum al abilite i tascj di direzionMaiusc al anule BlocMaiuscMaiusc nol anule BlocNum, invezit al sielç il tierç nivelMaiusc+BlocMaiuscSicilianeSiciliane (tastiere US)SlesianeSilvercrest Multimedia WirelessSindhiCingalese (US)Cingalese (fonetiche)SlovacheSlovache (disposizion ACC, nome letaris acentadis)Slovache (QWERTY)Slovache (QWERTY, sbare invierse complete)Slovache (Sun Type 6/7)Slovache (sbare invierse complete)SloveneSlovene (US)Slovene (cun virgulutis bassis)SpagnoleSpagnole (Dvorak)Spagnole (Americhe latine)Spagnole (Americhe latine, Colemak par zuiâ)Spagnole (Americhe latine, Colemak)Spagnole (Americhe latine, Dvorak)Spagnole (Americhe latine, tilde muarte)Spagnole (Americhe latine, cence tascj muarts)Spagnole (Macintosh)Spagnole (Sun Type 6/7)Spagnole (Windows)Spagnole (tilde muarte)Spagnole (cence tascj muarts)Tascj speciâi (Ctrl+Alt+&lt;tast&gt;) gjestîts intun servidôrSteelSeries Apex 300 (Apex RAW)Sun Type 6 (gjaponese)Sun Type 6 USB (gjaponese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (europeane)Sun Type 7 USBSun Type 7 USB (europeane)Sun Type 7 USB (gjaponese)/Gjaponese 106-tascjSun Type 7 USB (Unix)Compatibilitât cun tast SunSuper Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Scambiâ Ctrl e BlocMaiuscScambiâ Esc e BlocMaiuscScambiâ Alt a çampe cun Ctrl a çampeScambiâ Win a çampe cun Ctrl a çampeScambiâ Win diestri cun Ctrl diestriScambie cun parentesis cuadrisSvedeseSvedese (Dvorak A5)Svedese (Dvorak)Svedese (Dvorak, intl.)Svedese (Macintosh)Svedese (Sun Type 6/7)Svedese (Svdvorak)Svedese (US)Svedese (cence tascj muarts)Lengaç segns svedêsDaûr a passâ a une altre disposizionSymplon PaceBook tabletSiriacheSiriache (fonetiche)TaiwaneseTaiwanese (indigjene)TazicheTaziche (vecje maniere)Tamil (Inscrizion)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, codifiche TAB)Tamil (TamilNet '99 cun numars Tamil)Tamil (TamilNet '99)Tamil (TamilNet '99, codifiche TAB)Tamil (TamilNet '99, codifiche TSCII)Targa Visionary 811TatareTeluguTelugu (KaGaPa, fonetiche)Telugu (Sarala)TailandeseTailandese (Pattachote)Tailandese (TIS-820.2538)Il tast "&lt; &gt;"Il tast "&lt; &gt;" al sielç il 5ᵗ nivelIl tast "&lt; &gt;" al sielç il 5ᵗ nivel e cuant che al ven fracât cuntun altri seletôr di 5ᵗ nivel, al agjìs come bloc par une volteIl tast "&lt; &gt;" al agjìs come bloc par une volte sole, cuant che si frache adun cuntun altri seletôr di 3ᶜ nivelTibetaneTibetane (cun numars ASCII)A çampe di "A"Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcheTurche (Alt-Q)Turche (F)Turche (Gjermanie)Turche (Sun Type 6/7)Turche (intl., cun tascj muarts)TurkmeneTurkmene (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (modalitât 102/105:EU)TypeMatrix EZ-Reach 2030 USB (modalitât 106:JP)UdmurtUgaritiche al puest de arabeUcraineUcraine (Sun Type 6/7)Ucraine (Windows)Ucraine (omofoniche)Ucraine (vecje maniere)Ucraine (fonetiche)Ucraine (standard RSTU)Ucraine (machine di scrivi)Frecis e operadôrs matematics UnicodeFrecis e operadôrs matematics Unicode sul nivel predefinîtUnitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Windows)Urdu (alt. fonetiche)Urdu (fonetiche)Doprâ i LED de tastiere par indicâ i modificadôrsDoprâ i LED de tastiere par mostrâ la disposizion alternativeSolit spazi a ogni nivelUyghureUzbecheUzbeke (Afganistan)Uzbeke (Afganistan, OLPC)Uzbeche (Latine)VietnamiteVietnamite (AÐERTY)Vietnamite (Francese)Vietnamite (QĐERTY)Vietnamite (US)ViewSonic KU-306 InternetTastierute Wang 724 cun frecis e operadôrs matematics UnicodeTastierute Wang 724 cun frecis e operadôrs Unicode al nivel predefinîtWin al è aplicât a Stamp i Win abituâiWin+SpaziWinbook Model XP5WolofYahoo! InternetJakuteYorubaNo-union a largjece nule al secont nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivel, nuie al cuart nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivel, spazi stret no separabil al cuart nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivel, union a largjece nule al cuart nivelNo-union a largjece nule al secont nivel, union a largjece nule al tierç nivelNo-union a largjece nule al secont nivel, union a largjece nule al tierç nivel, spazi no separabil al cuart nivelNo-union a largjece nule al tierç nivel, union a largjece nule al cuart nivelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcspersonalizadedadede_llddlgdvdzPortatil eMachines m6800eeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunoldhun(lig)orpaphplpsptrorusasassatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh

Filemanager

Name Type Size Permission Actions
appstream-glib.mo File 18.52 KB 0644
aspell.mo File 23.63 KB 0644
at-spi2-core.mo File 658 B 0644
atk10.mo File 10.16 KB 0644
chkconfig.mo File 10.68 KB 0644
dnf-plugins-core.mo File 32.64 KB 0644
dnf.mo File 88.99 KB 0644
dos2unix.mo File 18.6 KB 0644
fprintd.mo File 7.01 KB 0644
gdk-pixbuf.mo File 21.67 KB 0644
glib-networking.mo File 7.08 KB 0644
glib20.mo File 74.39 KB 0644
gsettings-desktop-schemas.mo File 100.78 KB 0644
gst-plugins-base-1.0.mo File 20.31 KB 0644
gstreamer-1.0.mo File 27.33 KB 0644
gtk30.mo File 103.87 KB 0644
initscripts.mo File 21.24 KB 0644
iso_3166-1.mo File 23.21 KB 0644
iso_3166-3.mo File 1.02 KB 0644
iso_3166.mo File 23.21 KB 0644
iso_639-2.mo File 22.38 KB 0644
iso_639-5.mo File 6.88 KB 0644
iso_639.mo File 22.38 KB 0644
iso_639_5.mo File 6.88 KB 0644
json-glib-1.0.mo File 5.27 KB 0644
libdnf.mo File 19.46 KB 0644
libidn2.mo File 4.44 KB 0644
libosinfo.mo File 10.42 KB 0644
libpwquality.mo File 5.86 KB 0644
libsoup.mo File 4.22 KB 0644
p11-kit.mo File 7.88 KB 0644
parted.mo File 64.21 KB 0644
selinux-python.mo File 1.03 KB 0644
setroubleshoot-plugins.mo File 13.5 KB 0644
setroubleshoot.mo File 12.51 KB 0644
sudo.mo File 17.91 KB 0644
sudoers.mo File 9.26 KB 0644
sysstat.mo File 12.72 KB 0644
totem-pl-parser.mo File 979 B 0644
tracker3-miners.mo File 31.21 KB 0644
tracker3.mo File 10.95 KB 0644
xkeyboard-config.mo File 81.27 KB 0644